SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017914 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017914
Domain Number 1 Region: 310-474,863-1039
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.74e-112
Family Mammalian PLC 0.00000536
Further Details:      
 
Domain Number 2 Region: 633-730,791-817
Classification Level Classification E-value
Superfamily SH2 domain 4.41e-28
Family SH2 domain 0.0000646
Further Details:      
 
Domain Number 3 Region: 511-614
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-23
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 4 Region: 1060-1177
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.41e-22
Family PLC-like (P variant) 0.015
Further Details:      
 
Domain Number 5 Region: 739-823
Classification Level Classification E-value
Superfamily SH3-domain 5.08e-19
Family SH3-domain 0.00028
Further Details:      
 
Domain Number 6 Region: 26-134
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000422
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 7 Region: 165-306
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000814
Family Calbindin D9K 0.083
Further Details:      
 
Domain Number 8 Region: 461-510
Classification Level Classification E-value
Superfamily PH domain-like 0.00000734
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017914   Gene: ENSTRUG00000007265   Transcript: ENSTRUT00000017988
Sequence length 1258
Comment pep:known_by_projection scaffold:FUGU4:scaffold_241:277608:288270:1 gene:ENSTRUG00000007265 transcript:ENSTRUT00000017988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNSLPYIIYLSQTHQHTQLRTHIIERDLEMGAVMTVFRQKAERLTVQVIMETRQVAWTRT
VDKTDGVLDLFEIREIRPGRNSKDFERFKDGKDKHDDNACFTIFYGSQFVLNTLSLGVDS
VAEAQKWLTGLQLLWKETLEAPTPVLIESWLRKQMYSVNQTKTNSITVKELKALLPFLNY
KAPSSRTLKDKFQEVGSKKDRLDFEQFHKFYNHIMFEQNEVNVKLFYSNTDKPDASAVML
HDFQRFLVYDQKESWAADLNQVRELMSIFIDDTMRKTNDPVFTVSEFLGYLFSEENSIWD
KKFSEISYIDMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYVRALRLGCRCVELDCWEG
PGEPIIYHGWTRTTKIKFEDVVKAINDHAFVTSEFPVILSIEEHCPIEQQRQMARIFREV
FGDKLLTEPVEVIAEQLPSPTQLKGKIILKHKKLSVEGGGGGPIKDFRKGQKQGDLQIWD
PVDRQWNKHYCVISDDKLYYAEEEEQEEEDTQKYQDLHSTEPWFHGHMNGGRQMAERLIY
EYCAETGGRDGTFLVRPSDRFALSYTLSFWRDGRVQHCRIRTASQEGRFYYYLTANLHFP
SLISLIQHYRENPLRCQDFELRLTDAVAQQNPHLHEGWFYSNLSRGEAEDYLIKIPRDGA
FLIRQREGEPDSFAITFKGDGQVKHCRIQKEGKRYLLGTTTDFESLVELVNYYRKKPLYR
KIKLRYTVTPELVERFSTPNPNPNPIHKPNPNLIPNPNPNPNSKSVVRALYSYQAARPDE
LSFSKGALIYNISKENGDWWKGDYGGKVQHFFPANHVEEVSRITAPESSQQQDLDDNPLG
ELCKGVIDISKCNILNLKNGKNGKLHVLTLQDLEDDSLQFDLSAETLEELFKWYQAAWDI
TQRMISKIRQQVEVEKKEEVAMEMSDLVVYCQPRSKEKDRFGKDSYSYKEIRSFVENKVP
GKSRTKEFLLYNRKALSRTYPKGQRVESSNYDPYPLWAVGCHMVALNFQTADKYTQLNSA
LFSLNGCTGYVLQPEVMRSDSFDPLQEKNKLQYIIDCALQIIAARHLPRPGRSIASPFVE
VELCGHTEEKFKTFVYRDNGLNPVWKAPAEPITFRVYEAELTFLRFVVYEEDMFSDPNFL
AQATFPVKGIRSGYRSVPLRNGYSEKLELASLLVHVDARPAGRMEEDLYSSSSNLRKKSD
VSSEPFLYDTHTNLQHHALPRQQNHLSREFSTNEKQRISSEMLKQTMRMSKKKGGGRV
Download sequence
Identical sequences H2SZS6
ENSTRUP00000017914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]