SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018051 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018051
Domain Number 1 Region: 244-337,376-503
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.07e-56
Family Nuclear receptor ligand-binding domain 0.00000015
Further Details:      
 
Domain Number 2 Region: 121-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-27
Family Nuclear receptor 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018051   Gene: ENSTRUG00000007314   Transcript: ENSTRUT00000018125
Sequence length 507
Comment pep:known_by_projection scaffold:FUGU4:scaffold_105:315609:320977:-1 gene:ENSTRUG00000007314 transcript:ENSTRUT00000018125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVNHLWVYSTGMCLSPPVSLSDMLTDQGSPLLQDPDILTFPNYPSMQYTSMEPAMPSTPY
YSNHNYYPPYSGDEWYGIYELRKGSLEVSYDAETEDVSPAAPAVCKRTRHMSQAGRVKGE
ELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKSGGNCEMDMYMRRKCQECRL
RKCKEMGMLAECLLTEIQCKSKRLRKNTKASPEQSTGDETEAGDYGDGKHVSSTTKPSKK
KVSFTKEQQALMKVIIDAYNKHQIPQDVAKKLLQDKYSTEENFLLLTEMATSQVQVLVEF
TKNIPGFLSLDREDQIALLKGSAVEAMFLRSAQALNKKMPIGHTEVLEERIRKSAGPHTT
TEWGKIQSVQSKQAFNLFQWFSFLSIRGISEEFIKPMFNFYKSIGELHMVLEEQALLTTI
TILTPDRPYVKDQPAVERLQETALDLLRKMCVLHHPQEPQYFARLLGRLTELRTLSHYHA
EMLASWRVNDHKFTPLLCEIWDVQSDK
Download sequence
Identical sequences H2T063
ENSTRUP00000018051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]