SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018090 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018090
Domain Number 1 Region: 268-365
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 420-710
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000000209
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 190-281
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000685
Family I set domains 0.048
Further Details:      
 
Domain Number 4 Region: 16-69
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 5 Region: 109-186
Classification Level Classification E-value
Superfamily EF-hand 0.000000000117
Family Calmodulin-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018090   Gene: ENSTRUG00000007326   Transcript: ENSTRUT00000018164
Sequence length 767
Comment pep:known_by_projection scaffold:FUGU4:scaffold_71:228802:283308:-1 gene:ENSTRUG00000007326 transcript:ENSTRUT00000018164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRRTYCGRGRQCAVMADTGRAECVCQEKCRPSFVPVCGSDGRFYENHCEVYRTACLERRR
IYVVHSKDCFFKGNTCTMSEYNRLKSTLLNLQPKLQNLGQQDRQRDMEEKRTLVDTMFKY
LDVDQDGLLVGDELEKVSMKEHMEDSLLECTMQDLLRYDDYNNDGHLSLHEFYTAFQVVQ
LSLAEDQRISVSTVTVGLSAVLTCAIQGTLRPPIIWKRNGIILNFLDLEDINDFGDDGSL
YITKVTTIHMGNYSCHAYGYEHLCQTHVLQVNVPPVILVYPETQAQEPGVSASLHCHADG
IPNPKLLWLKNGLELQPRSSKQLSLLANGTELLIGSVRYEDTGAYTCIAKNEVGVDEDIS
SLFVEDSAKKTRLSVGNMFYVFSDEGITVLQPSECEIRRHMKRTERIVATYDEMCPKGEG
VSPQRCVWSSAVNVRDKYIYVTQPLLSRLLVVDIQAQKVVQAVATDPFPVKMLYDKSHDQ
VWVMTWGDMDRTHPTLQVIPQASVGEVHRAIRTTFQRVTDFFIPPTNLIITHVRFAFVFL
KNEPAVHKIDLETFHRVKTISLKNYSCIPVSMAYTHLSGFYFVQCQSKSRLRAPPQLLID
SVTDAVIGPNLNVTGRPFVSPDGRYVVTPDPGSAKLIVQTVSFQGELSLNLELDEPLAVS
DVAFQPSFVESNQHVVVATSGSSTDLLFADLSSGRVEVLRSLKEPLAPQAWPWGVPNRVV
VSSGLFGQYLVTPSAESLFVLNGKQRTPHCEVSDIKRGNTVVWVGEV
Download sequence
Identical sequences H2T0A2
ENSTRUP00000018090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]