SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018278 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018278
Domain Number 1 Region: 252-369
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.32e-55
Family Calsequestrin 0.00000254
Further Details:      
 
Domain Number 2 Region: 150-251
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.06e-26
Family Calsequestrin 0.0000748
Further Details:      
 
Domain Number 3 Region: 770-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-21
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 25-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.78e-18
Family Calsequestrin 0.0000175
Further Details:      
 
Domain Number 5 Region: 734-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000431
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018278   Gene: ENSTRUG00000007394   Transcript: ENSTRUT00000018354
Sequence length 852
Comment pep:known_by_projection scaffold:FUGU4:scaffold_296:212532:219608:-1 gene:ENSTRUG00000007394 transcript:ENSTRUT00000018354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWTWAIVAVLLSIGGLSLAKETLDYPEYDGKDRVHDLNAKNYKAVMKSYDVMVVYYHDH
PGSSRVAQRQFEIEELALELAAQVLEEFDDEDIGFGLLDAKLDKVVAKKLGLEESDSVYI
FTDDEIIEYDGEFAADTLVEFLYDALEDPVEIIDNSRELKGFENIDEDIKLVGYFKSHKS
EHFEAFADAAEEFHPHIKFYATFNSKVAKALELKLNEVDFYEPFMNDPVLIPGKPYTEEE
LVKFIEDNDRPTLRKLQPHNMYEIWDDDINGEHIIAFAEESDPDGFEFLDILKQVAEDNT
DNPNLSIVWIDPDDFPLLLPHWENTFGIDLSSPQIGVVKADDADSVWMKLDDDDLPSAEE
LEDWIEDVLSGEIDPDHDDDVQTNAGRRESSQKMSADVVNLQAQVEAVLGSLVKAATVEL
IKLFEGRFRATARGPDGTRCADGEETFVVTNSLSTEGTKRSVGVQVDPQDTCGVLVPPLD
EDGLKDRREQQQGAAAHRSQVGPARKQQTADVGQSRLCEADCPADGKAGTESVLDGTWDE
TLQNGSAQSSLAKSKPLIVLLDRLDAISPQKVKFVCPLNLGPEPPPAKPDVSEKPVKAEA
QQACISTTGGSAYSLSPSDGSLTPAEVGVWERVHTPKENNDLHMKLKLASPEQQSTRPCR
VHLVDMLTVPESERKFQDGDARGQNSKSRNGLHPLKDLRHHQGLHTGHRICCFSPCGNGT
WRLKKVVAHTREGYVCSTCHKTFTRRKILRRHQRFHSGEKPYSCPACSKTFALRKSLRRH
RRFHTGERPYMCPKCGKSFRLRENLKAHVRFHTGEKPYSCSTCGKMFRIARNLEKHGCHA
VLVPSFRTIAGL
Download sequence
Identical sequences H2T0U0
31033.ENSTRUP00000018278 ENSTRUP00000018278 ENSTRUP00000018278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]