SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018286 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018286
Domain Number 1 Region: 12-272
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-71
Family Nuclear receptor ligand-binding domain 0.00000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018286   Gene: ENSTRUG00000007399   Transcript: ENSTRUT00000018362
Sequence length 316
Comment pep:known_by_projection scaffold:FUGU4:scaffold_274:340917:348072:-1 gene:ENSTRUG00000007399 transcript:ENSTRUT00000018362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRKLIPILCSPSAVRNDRNKKKKESPKPELAESYELTAELETIIEKIRKAHQETFPSLCQ
LGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRVPGFTALTIADQITLLKAA
CLDILILRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPIEMDDT
ETGLLSAICLISGDRQDLEEPSKVDQLQEPLLEALKIYVRKRRPSKPHMFPKTLMKITDL
RSISAKGAERVISLKMEIPGSMPPLIQEMLENSEGQDGQSSSSSSSSSASADGGASPSSK
SSPDEEDATVATPESP
Download sequence
Identical sequences H2T0U8
ENSTRUP00000018286 31033.ENSTRUP00000018286 ENSTRUP00000018286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]