SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018382 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018382
Domain Number 1 Region: 231-493
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.11e-70
Family Nuclear receptor ligand-binding domain 0.00000000022
Further Details:      
 
Domain Number 2 Region: 125-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-26
Family Nuclear receptor 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018382   Gene: ENSTRUG00000007433   Transcript: ENSTRUT00000018458
Sequence length 495
Comment pep:known_by_projection scaffold:FUGU4:scaffold_46:561084:563570:1 gene:ENSTRUG00000007433 transcript:ENSTRUT00000018458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHMWEDPGSLHTFHQNYVAATSHMMDQRKNPVSRLSLFSFKQSPPGTPVSSCQMRFDGPL
HVSMNHDNPGVHRGLDGQSFAVPSAIRKQAGLAFPHSLQLGHGHQLVDSQVPSPPSRGSP
SNEGVCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQF
CRFQKCLVVGMVREGKPLIHLDHLYFSHMTAERLSLRMIYFELFFLNRVVRTDSLKGRRG
RLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPSMSALDYSRFQASPDYQMAGDNTQHI
QQFYDLLTGSMEIIRGWAEKIPGFSDLPKQDQDLLFESAFLEVFVLRLSYRSNPIEGKLI
FCNGVVLHRLQCVRGFGEWVDAIVEFSSSLQSMSIDISAFSCIAALAMVTERHGLKEPKR
VEDLQNKIVNCLKDQVTFNGGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVP
PPAIIDKLFLDTLPF
Download sequence
Identical sequences H2T144
31033.ENSTRUP00000018382 ENSTRUP00000018382 ENSTRUP00000018382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]