SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018401 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018401
Domain Number 1 Region: 121-326
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-53
Family DBL homology domain (DH-domain) 0.000000347
Further Details:      
 
Domain Number 2 Region: 312-473
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-34
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 3 Region: 551-681
Classification Level Classification E-value
Superfamily SH2 domain 1.66e-29
Family SH2 domain 0.00059
Further Details:      
 
Domain Number 4 Region: 700-760
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-22
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 5 Region: 2-154
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000241
Family Calponin-homology domain, CH-domain 0.025
Further Details:      
 
Domain Number 6 Region: 504-580
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000204
Family SH3-domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018401   Gene: ENSTRUG00000007437   Transcript: ENSTRUT00000018477
Sequence length 763
Comment pep:known_by_projection scaffold:FUGU4:scaffold_249:286547:318239:1 gene:ENSTRUG00000007437 transcript:ENSTRUT00000018477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQFLCLKNIRTFLMACTEVFGMRKSELFESFDLFDVRDFGKVVDTLSKLSHTAIAQQTGI
RSFPSEESVEDEDIYNHLEDLIDEKVVEDEEDLYDCVYDEEDGGEIYEDLMKTEALPPPK
QAEIDIRSCCLTEIKQTEEKYTETLESIEKHFMSPLTSYLSAAEIESVFVNIPELVKVHK
CLLVEVQDSLHHRSAQNLYQIFLNFKERLLIYGKYCSHVETAIGTLDELCKDREDIRMKL
EECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKGNLRLALDAMKDLAQ
YVNEVKRDNETLREIDQYQKSIENLNQALSNYGRPKGDGEVRVASVDKRAKQDRHIFLFD
AAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKETRKWSYGFYLTHKQGQSGFEFFFKT
KELKKKWLEQFGMAISNILPENATNNFHDFHMHTFERITSCNSCHMLLRGVFNQGYLCSK
CGLGAHKECLGRFSGCGKTGPDLSKPVALSLPKMLVIRSYFGVPSPASGPALSIEMGDII
ELLCADIHSPWWQGRILSTKEVGFFPSDAVKPCPCVPKPVDYSSQPWFAGPIERLQAEAE
LINRVNGTYLVRHRSREYTEYAISIKYNNDVKHIKILTKEGCFYIAENKKFRSILELIEY
YKHHSLREGFRSLDTTLHFPYREQENAALQRLSRSGSNMLTPKVIGVAIARYDFSSRDTR
ELSLQEGDVVKIYTKSGANGWWRGEVNGRVGWFPSTYVEEGEE
Download sequence
Identical sequences H2T163
ENSTRUP00000018401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]