SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018540 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018540
Domain Number 1 Region: 342-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-47
Family SPRY domain 0.00071
Further Details:      
 
Domain Number 2 Region: 10-83
Classification Level Classification E-value
Superfamily RING/U-box 7.54e-20
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 141-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000702
Family B-box zinc-binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018540   Gene: ENSTRUG00000007483   Transcript: ENSTRUT00000018616
Sequence length 528
Comment pep:novel scaffold:FUGU4:scaffold_90:203030:204924:-1 gene:ENSTRUG00000007483 transcript:ENSTRUT00000018616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKGAQLDWDIASCSICLDALKNPVTVPCGHNYCMDCINTYWKAAERGQQSYVCPQCRK
SFTPRPVLTKNTMLAAIVEELKKTGLHEAPADHGHAGSGDVACDVCTTVKAVKSCLVCLV
SFCENHLQPHHQMPPLMTHKLVEPCQNLQEKACGSHAEVKTMFCRTDQQCICRLCLAESH
KGHDTVSAAAERREKQRNLAVRQLKIQQMIRERKEDVTVLQQRVEVINHSANKAVKDSHQ
IITQLIDFLVEKRVRSHQEAEVSQVKEAEKKLECDIVELRSREDELRRILHIEDDNQFLQ
RITNTSQKIFRKNMAKISQRRAEKNSLQSKPQSEPQSEPQSRRDFLEYLCKLTLDADTAH
TQLHLSAGNRTATVTNQNLNYPSHPGRFTQCCQVLSKGSMTGRCYWEVKWDGPAVYIAVA
YADVKRDGQWTQSGFGSTDKSWALYCDNAKYIFCHNSCTTPVSGPPSSALGVYLDHSTGL
LSFYSVTSEALTLLHKVHTTFTQPLHAGFSFYNYPGTKAVTIIVNLVY
Download sequence
Identical sequences H2T1K2
ENSTRUP00000018540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]