SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018541 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018541
Domain Number 1 Region: 355-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-46
Family SPRY domain 0.00071
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily RING/U-box 5.89e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 129-188
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000733
Family B-box zinc-binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018541   Gene: ENSTRUG00000007483   Transcript: ENSTRUT00000018617
Sequence length 539
Comment pep:novel scaffold:FUGU4:scaffold_90:203149:204888:-1 gene:ENSTRUG00000007483 transcript:ENSTRUT00000018617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASCSICLDALKNPVTVPCGHNYCMDCINTYWKAAERGQQSYVCPQCRKSFTPRPVLTKNT
MLAAIVEELKKTGLHEAPADHGHAGSGDVACDVCTTVKAVKSCLVCLVSFCENHLQPHHQ
MPPLMTHKLVEPCQNLQEKACGSHAEVKTMFCRTDQQCICRLCLAESHKGHDTVSAAAER
REKQRNLAVRQLKIQQMIRERKEDVTVLQQRVEVINHSANKAVKDSHQIITQLIDFLVEK
RVRSHQEAEVSQVKEAEKKLECDIVELRSREDELRRILHIEDDNQFLQSPAGDPPRFSES
STGYFEDVTAFLSKITNTSQKIFRKNMAKISQRRAEKNSLQSKPQSEPQSEPQSRRDFLE
YLCKLTLDADTAHTQLHLSAGNRTATVTNQNLNYPSHPGRFTQCCQVLSKGSMTGRCYWE
VKWDGPAVYIAVAYADVKRDGQWTQSGFGSTDKSWALYCDNAKYIFCHNSCTTPVSGPPS
SALGVYLDHSTGLLSFYSVTSEALTLLHKVHTTFTQPLHAGFSFYNYPGTKAHGCEITT
Download sequence
Identical sequences H2T1K3
ENSTRUP00000018541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]