SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019171 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019171
Domain Number 1 Region: 485-797
Classification Level Classification E-value
Superfamily L domain-like 5.95e-43
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 2 Region: 24-426
Classification Level Classification E-value
Superfamily L domain-like 1.67e-38
Family Ngr ectodomain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 891-1040
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-28
Family Toll/Interleukin receptor TIR domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019171   Gene: ENSTRUG00000007717   Transcript: ENSTRUT00000019249
Sequence length 1055
Comment pep:known_by_projection scaffold:FUGU4:scaffold_93:250450:254485:1 gene:ENSTRUG00000007717 transcript:ENSTRUT00000019249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPFMYWTRKTTMRFLILCQLLPIVSSINPIFLPCDTDANTSRVDCSDRPLRRVPLIKSDT
VTSLRLSRTKIRHLWQYDLSGVPNLRAFTMADNCQPSSMKASLHDCEVKIDHGVFRNLSL
LQVLNLSGNSLTSLPKLPANLRVLNLQRNHLFNIVEPLKTPHLQELYLTKNCFYANPCQQ
SLEISKTVFRELSRLKTLTLAYNNLTSVPEGLPSSLEILDLSENTITEVLEGAFADLTHL
RELNLEWNCQRCDRAARPCFPCPRHLPLQLHSKSFYANKSTLTYLNLRGNSLRTFPKGLF
QPLKNLKMLDLSDNFLSYAIQNGTFFAELTSLAWISLIYNYEPLKMFPELFLSPHIGDIS
GLQYLLLSGNFFHSLSGQSFEVLSKLRNLKKLELRMNFIDNINMKALHQVPSLVHIDLSQ
NRLSFIPQCSVSPAERESHHNQNVRDLSFSQPFLMETKPNVTFGFNFLDQSHRLETSQSF
PTQSSPLWETFCKNKVTFDLSQNDIMSVNQEVLAGMENAVCLDLSFNYMSQALKYGMFSS
MKHLVFLNLSYNRLDFYYNESFSELNNTLKLLDLSNNDFHFKMRGMGHRLTFIKNLVNLE
VLSLANNAIAMRIDQRLVSASLKQLSFNGNDLNTMWSSENNQYVNFFHNLTSLTYLDISD
NKLRLVSPEVLCNLPRSLQNLSLSNNRLNYFPWENISVLSNLRHLDLSQNFISFLPYTVV
HAAEPLSLLDLSHNRIGYVPRSFFLAMNSLQRLYLSHNQLKQLNQHFLPAPFKNGSGPRT
LSLHVNPFKCDCDASWFADFLRNTPIEIPHLTTNVHCEYPESQRGKTILSMDQRSCQDIY
GNLASVVCSFLVIGFTVLPLLKHLYGWDLWYSLQVLWAGFKGYSQLTGQDTKYNYDAFVV
FDTSDLAVRDWVYNELLVNLENSAHRMFCLCLEERDWVPGFSCIENLHNAVSSSVKTMFV
LSTGTIESMSGMIRQAFFMVQQRLLDEKVDTAVLVLLDEMFPKLKYLQLRKRLCRKSVLS
WPRNPKAQPLFWNQLRMALSSDNLSFYDNNMSESF
Download sequence
Identical sequences H2T3D3
ENSTRUP00000019171 31033.ENSTRUP00000019171 ENSTRUP00000019171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]