SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019808 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019808
Domain Number 1 Region: 337-520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-67
Family SPRY domain 0.00000786
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 1.66e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 141-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019808   Gene: ENSTRUG00000007952   Transcript: ENSTRUT00000019889
Sequence length 523
Comment pep:known_by_projection scaffold:FUGU4:scaffold_194:209841:212865:1 gene:ENSTRUG00000007952 transcript:ENSTRUT00000019889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGAFLCEDQFTCSICLEVFENPVSTPCGHSFCQRCISSYWDGGRGGNRVYFCPICKE
SFRKRPELHINRTLKEITEQFKHIASSGSPEEECLRQQGLTLQEVSSIQRVQLLTHPPTT
HHLHAGMFTFVRYTLSGPSSSSPPLPLCPVHLRGLEFFCRTDNICICSTCVDKADHRGHN
ITPAKREWQIRKTELRDLLSEREKKVEEIQESLEEIQAAAESQTDGAVGVFSKFISSLER
CQADVLEVIELSRRAAEHRAQSLLKELEEEISELKNRSAALNLLTRSEDYVHFLKVSKRR
HDTFPGLSTHPPTKDWTGACVESELTSGAALRTVETRRVQEYAADITLDPYTAHPRLLIS
PDGKQVFCGERHQQIPDNPERFDRVVCVLAHQGFSSGRHYWEVDVGGKSDWDLGVASRSV
NRKGKITVSPAHGYWFLSLRDQTEYAFRTEPSTSLTVSIRPSRVGIYVDFEKGVVSFYNV
EARVLIYTFTDTFPDTIYPFFSPCTNKSGRNEAPLIIRPVANT
Download sequence
Identical sequences H2T570
ENSTRUP00000019808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]