SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019810 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019810
Domain Number 1 Region: 395-564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-64
Family SPRY domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 144-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019810   Gene: ENSTRUG00000007952   Transcript: ENSTRUT00000019891
Sequence length 570
Comment pep:known_by_projection scaffold:FUGU4:scaffold_194:209850:213110:1 gene:ENSTRUG00000007952 transcript:ENSTRUT00000019891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAFLCEDQFTCSICLEVFENPVSTPCGHSFCQRCISSYWDGGRGGNRVYFCPICKESFR
KRPELHINRTLKEITEQFKHIASSGSPEEGGDGGGLGRGLGKDPVSQSHLTLTQRPGPVH
VHGGECLSRMFTFVRYTLSGPSSSSPPLPLCPVHLRGLEFFCRTDNICICSTCVDKADHR
GHNITPAKREWQIRKSQLGISETELRDLLSEREKKVEEIQESLEEIQAAAESQTDGAVGV
FSKFISSLERCQADVLEVIELSRRAAEHRAQSLLKELEEEISELKNRSAALNLLTRSEDY
VHFLKTFPGLSTHPPTKDWTGACVESELTSGAALRTVGQVMEQMQEEMQKLPESCTSCHI
LKQTTNPSKRVMSRGWSLPGVYAAVRKSPGTFGNFMAFKPDITLDPYTAHPRLLISPDGK
QVFCGERHQQIPDNPERFDRVVCVLAHQGFSSGRHYWEVDVGGKSDWDLGVASRSVNRKG
KITVSPAHGYWFLSLRDQTEYAFRTEPSTSLTVSIRPSRVGIYVDFEKGVVSFYNVEARV
LIYTFTDTFPDTIYPFFSPCTNKSVICEIT
Download sequence
Identical sequences H2T572
ENSTRUP00000019810 31033.ENSTRUP00000019810 ENSTRUP00000019810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]