SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020083 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020083
Domain Number 1 Region: 483-807
Classification Level Classification E-value
Superfamily L domain-like 2.27e-40
Family Ngr ectodomain-like 0.027
Further Details:      
 
Domain Number 2 Region: 30-433
Classification Level Classification E-value
Superfamily L domain-like 6.8e-34
Family Ngr ectodomain-like 0.0044
Further Details:      
 
Domain Number 3 Region: 864-1018
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-30
Family Toll/Interleukin receptor TIR domain 0.0000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020083   Gene: ENSTRUG00000008051   Transcript: ENSTRUT00000020165
Sequence length 1033
Comment pep:known_by_projection scaffold:FUGU4:scaffold_103:438596:446063:1 gene:ENSTRUG00000008051 transcript:ENSTRUT00000020165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTIHSLFYNILGLWCPLCILTANVSYPKTLPCDVTNNGSVVNVDCTERSLKGVPVGIPRD
VTNLTLTINHIPNFNSSSFQGLDNLREIDMRCNCVPVKIGPKDRICTESVTIEENTFTSL
RNLQSLYLDGNQLYIIPEGLPSSLILLSLEVNHIYYISKANLSEIRNIESLYLGQNCYYR
NPCNFSYGIEEGAFLELHNLKLLSLKSNNLSFIPHHLPSSLKELYLYNNNFQQVTDEDFK
NLTNLEILDISGNCPRCYNVPFPCNPCPNNSPLQISKIHPNAFYNLTNLETLNLGGNSLK
ELNPSWFERLYKLKQLFLAFNFLLKPITEQGAFLKYIPNIKKMDLSFNYNLRSYPKTINL
SPEFSNLAALQTLHLEGLVFQNIGPDTLRPLYQLKNLSVLNLGTNFIIQADSSIFKKLSH
LKMIYLGENRLYPIPEKNMPSLSRQYNQRLDFSVSSYMKPHGRDYFFKISQTLIKQECFD
AGKVLSLNSNNFLFISTKEFEGDIKCLNLSRNGFAPALNGTEFSFLPNLTYLDLSFNKID
LAYSLAFNDLKKLQVLDLSYNPHYFNVQGITHKVNFLRNLPVLRVLNMSHNDISTLTTKY
MESKSLAELRFTHNYLGTLWKENDLSYKKLFTKLTNLTILDISFNQIIKIPDEMYKHLPQ
NLTTLIISHNFLTDFKWNKLIFLPQIKVLDLSFNRLTNVTGIHIAHTLTLLNLKHNGISH
LDDGFLMGAKRLQVLNLKSNQLTTINESTFQPRPENQFQTLYLEENPFQCTCDLLDFILW
IENSDVKIPGLATDVKCDAPANQKGRVLIKFDITQCVNNSEAFLIYILTSSFVIGFMLVT
TVAHLFYWDATYVLHYMKAKLKGYSSLNSSEILYGAFVTYDTRDPHVSEWVMKNLLVKLE
EEGEKNLPLCLEERDWTPGVPLVDNLTQSIRYSRKTLFVLTQDYVKTGIFKMAMYLAHQR
LLDENVDVIVLLLLEPVLQHSHFLRLRRRLCGESVVDWPRTAAAEPWFWQNLRNVVRVEN
QVMYNKNYSKYFT
Download sequence
Identical sequences H2T5Z4
ENSTRUP00000020083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]