SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020330 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020330
Domain Number 1 Region: 315-449
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-39
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 603-749
Classification Level Classification E-value
Superfamily C-type lectin-like 7.04e-33
Family C-type lectin domain 0.0000811
Further Details:      
 
Domain Number 3 Region: 901-1047
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-32
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 4 Region: 460-590
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-31
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 756-882
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-30
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 6 Region: 1200-1319
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-30
Family C-type lectin domain 0.00089
Further Details:      
 
Domain Number 7 Region: 181-307
Classification Level Classification E-value
Superfamily C-type lectin-like 1.25e-28
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 8 Region: 1046-1170
Classification Level Classification E-value
Superfamily C-type lectin-like 1.16e-25
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 9 Region: 115-172
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000168
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 10 Region: 9-116
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000168
Family Cysteine rich domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020330   Gene: ENSTRUG00000008136   Transcript: ENSTRUT00000020415
Sequence length 1418
Comment pep:known_by_projection scaffold:FUGU4:scaffold_80:343181:357087:1 gene:ENSTRUG00000008136 transcript:ENSTRUT00000020415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLTSKATGLCILKKSNRCLDVRWTTGDRLFATITRKCLGAQGKSLGSEVSFYDCDDKSE
LQKWECKNETLLALKGQQLYIEVKPDEALSLSRTVGPNNHLTVTGMTRGACSRTYRELFT
LEGNAFGKPCAFPFFYKDRWFGECTTYDSSTKRAWCAVGTRFENEQWGYCPTTCELATDK
WIKNLVTGANYQLNTQSVLTWSQAETSCRQQGASLLSVSDPHQQAFVSGRIPPGKQKLWI
GLVLDPEHGWRWSDLKPFRYLRWSPGNPLPNPGHNCAFLDTAGQHTWQSASCTKKLGYIC
YKDGAPPAPSESTENTSIEQGFCSNPWIPYNGHCFYLNRSPQTWYNAQKECRKEGGDLVS
VQNVEEQSFIISQLGFASTDELWIGFNDIKIEGLFDWSDHSSVSFTSWTFGKPDVSTDAE
DCVLITGENGNWVDRLCERKHGFICMKQSTTESTGDEVEVNIGCKLGWKRHGSYCYLIGT
AMKTFDEAKSDCETSGSYLADVSNGVDNAFLVSLVGLRPEKHFWLGLSNQKNIDEFVWTQ
GGSVKYTHWNAGMPGTEEDGCVAMRTGPLAGLWDLLPCTNTSKYICKHLAEGAVLTAPPP
TQMPLKCEQGWNRIGTRNYCVKFFTGPRSNEKTWFEARDYCRAIGGDLLSLHNQGELLIA
RYGHRHGRAWIGLHAPDPNTGYVWSDGSPVNFLHWQEGEPNNHNNDESCTEFRMHNSWEE
SGSWNDVNCESYNDWLCQIRAGVTPKPPPNDTVADFNITSDGWLEWRGNQYYLNRNPMYM
EKARHLCQQKHGDLVSISSKEENNFLWKQIARSYGSYYIGLSVDIDGRFWWMDGSSLGLQ
KWDENQPNPDTIDANCVTMNYYMGYWRTCNCGQEHEFICKRSGSTPANTTAAPTVPPKGG
CPLKWTKFDSKCYSIITDQVASWEDARKQCITIGGNLVSIPTRRIQAFLTTKMAELSATN
LWIGLNSLNQDGFYWTDGKPRQYTNWGYSRSRRRPGTFYQRWNEEDCVVMNSNAGQSIGK
WLIKSCNETYGFVCTRKVDPNIPSQPDTYVPKIYVSVGNDSIKVVTTNLTWDDAKKNCEA
DKASLASLRNEWSQAYIELLVLNLKAPVWIGLNKKQTGGYFKYIDNWHLKFASWAEDEPS
SDKPCVYLDVDGQWRTAFCNQTMNSVCMQTTGDAEVPPTESSVFPGVCPEDTKEEYHQSY
SWLPFKGYCYLFVTDEIEWANAAGSCVRHGGVLASIEDPAEQAFIQNSLDVFHGSHSSFW
IGLYKTHKGTWQWLDKTVLDYTNWGANEPDADYGEMVSSDGTWRSGKRWHDRAYICKTPK
DSDSTPDYPCCMFAVSSTEFRTGRDSQGRGHTSLIVVLIIVAVCSLAAGAFIIYKKSPRL
IPTFDNPLYFESDRTQPDVVDTNRLIENAEVENTEPII
Download sequence
Identical sequences H2T6P1
ENSTRUP00000020330 31033.ENSTRUP00000020330 ENSTRUP00000020330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]