SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020332 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020332
Domain Number 1 Region: 303-435
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-39
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 723-852
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-31
Family C-type lectin domain 0.00056
Further Details:      
 
Domain Number 3 Region: 446-575
Classification Level Classification E-value
Superfamily C-type lectin-like 5.74e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 4 Region: 871-1021
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-30
Family C-type lectin domain 0.00068
Further Details:      
 
Domain Number 5 Region: 1158-1280
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-30
Family C-type lectin domain 0.00086
Further Details:      
 
Domain Number 6 Region: 165-291
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-29
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1020-1149
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-25
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 8 Region: 588-725
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-25
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 9 Region: 102-159
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000016
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 10 Region: 3-103
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000754
Family Cysteine rich domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020332   Gene: ENSTRUG00000008136   Transcript: ENSTRUT00000020417
Sequence length 1356
Comment pep:known_by_projection scaffold:FUGU4:scaffold_80:343220:357075:1 gene:ENSTRUG00000008136 transcript:ENSTRUT00000020417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKSNRCLDVRWTTGDRLFATITRKCLGAQGKSLGSEVSFYDCDDKSELQKWECKNETLLA
LKGQQLYIEVKPDEALSLSRTVGPNNHLTVTGMTRGACSRTYRELFTLEGNAFGKPCAFP
FFYKDRWFGECTTYDSSTKRAWCAVGTRFENEQWGYCPTTSTDKWIKNLVTGANYQLNTQ
SVLTWSQAETSCRQQGASLLSVSDPHQQAFVSAQLESGKQKLWIGLVLDPEHGWRWSDLK
PFRYLRWSPGNPLPNPGHNCAFLDTAGQHTWQSASCTKKLGYICYKDGAPPAPSESTENT
SISVEQGFCSNPWIPYNGHCFYLNRSPQTWYNAQKECRKEGGDLVSVQNVEEQSFIISQL
GFASTDELWIGFNDIKIEGLFDWSDHSSVSFTSWTFGKPDVSTDAEDCVLITGENGNWVD
RLCERKHGFICMKQSTTESTGDEVEVNIGCKLGWKRHGSYCYLIGTAMKTFDEAKSDCET
SGSYLADVSNGVDNAFLVSLVGLRPEKHFWLGLSNQKNIDEFVWTQGGSVKYTHWNAGMP
GYEQGCVAMRTGPLAGLWDLLPCTNTSKYICKHLAEGAVLTAPPPTQMPLKCEQGWNRIG
TRNYCVKFFTGPRSNEKTWFEARDYCRAIGGDLLSLHNQGELLIARYVCHRHGRAWIGLH
APDPNTGYVWSDGSPVSGPFLTPPGSGLGMHNSWEESGSWNDVNCESYNDWLCQIRAGVT
PKPPPNDTVADGWLEWRGNQYYLNRNPMYMEKARHLCQQKHGDLVSISSKEENNFLWKQI
ARSYGSYYIGLSVDIDGRFWWMDGSSLGLQKWDENQPNPDTIDANCVTMNYYMGYWRTCN
CGQEHEFICKRSGSTPANTTAAPTVPPKGGCPLKWTKFDSKCYSIITDQVASWEDARKQC
ITIGGNLVSIPTRRIQAFLTTKMAELSATNLWIGLNSLNQDGFYWTDGKPRQYTNWGYSL
SNCKRLESSSKMQIQEKILNCVVMNSNAGQSIGKWLIKSCNETYGFVCTRKVDPNIPSQP
DTYVPKIYVSVGNDSIKVVTTNLTWDDAKKNCEADKASLASLRNEWSQAYIELLVLNLKA
PVWIGLNKKQTGGYFKYIDNWHLKFASWAEDEPSSDKPCVYLDVDGQWRTAFCNQTMNSV
CMQTTGVCPEDTKEEYHQSYSWLPFKGYCYLFVTDEIEWANAAGSCVRHGGVLASIEDPA
EQAFIQNSLDVFHGSHSSFWIGLYKTHKGTWQWLDKTVLDYTNWGANEPDADYGEMVSSD
GTWRSGKRWHDRAYICKTPKEFRTGRDSQGRGHTSLIVVLIIVAVCSLAAGAFIIYKKSP
RLIPTFDNPLYFESDRTQPDVVDTNRLIENAEVENT
Download sequence
Identical sequences H2T6P3
ENSTRUP00000020332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]