SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020333 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020333
Domain Number 1 Region: 293-427
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-39
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 575-723
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-34
Family C-type lectin domain 0.0000483
Further Details:      
 
Domain Number 3 Region: 888-1034
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-32
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 4 Region: 438-568
Classification Level Classification E-value
Superfamily C-type lectin-like 8.77e-31
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 743-869
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-30
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 6 Region: 1185-1307
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-30
Family C-type lectin domain 0.00086
Further Details:      
 
Domain Number 7 Region: 159-285
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-28
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 8 Region: 1033-1157
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-25
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 9 Region: 93-150
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000166
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 10 Region: 1-94
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000011
Family Cysteine rich domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020333   Gene: ENSTRUG00000008136   Transcript: ENSTRUT00000020418
Sequence length 1401
Comment pep:known_by_projection scaffold:FUGU4:scaffold_80:343247:357087:1 gene:ENSTRUG00000008136 transcript:ENSTRUT00000020418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWTTGDRLFATITRKCLGAQGKSLGSEVSFYDCDDKSELQKWECKNETLLALKGQQLYIE
VKPDEALSLSRTVGPNNHLTVTGMTRGACSRTYRELFTLEGNAFGKPCAFPFFYKDRWFG
ECTTYDSSTKRAWCAVGTRFENEQWGYCPTTCELATDKWIKNLVTGANYQLNTQSVLTWS
QAETSCRQQGASLLSVSDPHQQAFVSGRIPPGKQKLWIGLVLDPEHGWRWSDLKPFRYLR
WSPGNPLPNPGHNCAFLDTAGQHTWQSASCTKKLGYICYKDGAPPAPSESTENTSIEQGF
CSNPWIPYNGHCFYLNRSPQTWYNAQKECRKEGGDLVSVQNVEEQSFIISQLGFASTDEL
WIGFNDIKIEGLFDWSDHSSVSFTSWTFGKPDVSTDAEDCVLITGENGNWVDRLCERKHG
FICMKQSTTESTGDEVEVNIGCKLGWKRHGSYCYLIGTAMKTFDEAKSDCETSGSYLADV
SNGVDNAFLVSLVGLRPEKHFWLGLSNQKNIDEFVWTQGGSVKYTHWNAGMPGTEEDGCV
AMRTGPLAGLWDLLPCTNTSKYICKHLAEGAVLTAPPPTQMPLKCEQGWNRIGTRNYCVK
FFTGPRSNEKTWFEARDYCRAIGGDLLSLHNQGELLIARHFISSYFMKHGRAWIGLHAPD
PNTGYVWSDGSPVNFLHWQEGEPNNHNNDESCTEFRMHNSWEESGSWNDVNCESYNDWLC
QIRAGKFSGVTPKPPPNDTVADFNITSDGWLEWRGNQYYLNRNPMYMEKARHLCQQKHGD
LVSISSKEENNFLWKQIARSYGSYYIGLSVDIDGRFWWMDGSSLGLQKWDENQPNPDTID
ANCVTMNYYMGYWRTCNCGQEHEFICKRSGSTPANTTAAPTVPPKGGCPLKWTKFDSKCY
SIITDQVASWEDARKQCITIGGNLVSIPTRRIQAFLTTKMAELSATNLWIGLNSLNQDGF
YWTDGKPRQYTNWGYSRSRRRPGTFYQRWNEEDCVVMNSNAGQSIGKWLIKSCNETYGFV
CTRKVDPNIPSQPDTYVPKIYVSVGNDSIKVVTTNLTWDDAKKNCEADKASLASLRNEWS
QAYIELLVLNLKAPVWIGLNKKQTGGYFKYIDNWHLKFASWAEDEPSSDKPCVYLDVDGQ
WRTAFCNQTMNSVCMQTTGDAEVPPTESSVFPGVCPEDTKEEYHQSYSWLPFKGYCYLFV
TDEIEWANAAGSCVRHGGVLASIEDPAEQAFIQNSLDVFHGSHSSFWIGLYKTHKGTWQW
LDKTVLDYTNWGANEPDADYGEMVSSDGTWRSGKRWHDRAYICKTPKIISQKTVNSTIST
YKFRTGRDSQGRGHTSLIVVLIIVAVCSLAAGAFIIYKKSPRLIPTFDNPLYFESDRTQP
DVVDTNRLIENAEVENTEPII
Download sequence
Identical sequences H2T6P4
ENSTRUP00000020333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]