SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020334 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020334
Domain Number 1 Region: 290-424
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-39
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 876-1025
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-33
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 3 Region: 1153-1296
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-31
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 4 Region: 435-565
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-31
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 735-857
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-30
Family C-type lectin domain 0.00061
Further Details:      
 
Domain Number 6 Region: 156-282
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-28
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 7 Region: 1024-1152
Classification Level Classification E-value
Superfamily C-type lectin-like 8.29e-26
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 8 Region: 572-724
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-25
Family C-type lectin domain 0.0000889
Further Details:      
 
Domain Number 9 Region: 93-150
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000163
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 10 Region: 1-94
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000108
Family Cysteine rich domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020334   Gene: ENSTRUG00000008136   Transcript: ENSTRUT00000020419
Sequence length 1374
Comment pep:known_by_projection scaffold:FUGU4:scaffold_80:343247:357081:1 gene:ENSTRUG00000008136 transcript:ENSTRUT00000020419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWTTGDRLFATITRKCLGAQGKSLGSEVSFYDCDDKSELQKWECKNETLLALKGQQLYIE
VKPDEALSLSRTVGPNNHLTVTGMTRGACSRTYRELFTLEGNAFGKPCAFPFFYKDRWFG
ECTTYDSSTKRAWCAVGTRFENEQWGYCPTTSTDKWIKNLVTGANYQLNTQSVLTWSQAE
TSCRQQGASLLSVSDPHQQAFVSGRIPPGKQKLWIGLVLDPEHGWRWSDLKPFRYLRWSP
GNPLPNPGHNCAFLDTAGQHTWQSASCTKKLGYICYKDGAPPAPSESTENTSIEQGFCSN
PWIPYNGHCFYLNRSPQTWYNAQKECRKEGGDLVSVQNVEEQSFIISQLGFASTDELWIG
FNDIKIEGLFDWSDHSSVSFTSWTFGKPDVSTDAEDCVLITGENGNWVDRLCERKHGFIC
MKQSTTESTGDEVEVNIGCKLGWKRHGSYCYLIGTAMKTFDEAKSDCETSGSYLADVSNG
VDNAFLVSLVGLRPEKHFWLGLSNQKNIDEFVWTQGGSVKYTHWNAGMPGTEEDGCVAMR
TGPLAGLWDLLPCTNTSKYICKHLAEGAVLTAPPPTQMPLKCEQGWNRIGTRNYCVKFFT
GPRSNEKTWFEARDYCRAIGGDLLSLHNQGELLIARYENDIYLFFVCHRHGRAWIGLHAP
DPNTGYVWSWTKVNFLHWQEGEPNNHNNDESCTEFRMHNSWEESGSWNDVNCESYNDWLC
QIRAVLNRADFNITSDGWLEWRGNQYYLNRNPMYMEKARHLCQQKHGDLVSISSKEENNF
LWKQIARSYGSYYIGLSVDIDGRFWWMDGSSLGLQKWDENQPNPDTIDANCVTMNYYMGY
WRTCNCGQEHEFICKRSGSTPANTTAAPTVPPKGGCPLKWTKFDSKCYSIITDQVASWED
ARKQCITIGGNLVSIPTRRIQAFLTTKMAELSATNLWIGLNSLNQDGFYWTDGKPRQYTN
WVPKNPSIDSVICPTVKGWKVLEDCVVMNSNAGQSIGKWLIKSCNETYGFVCTRKVDPNI
PSQPDTYVPKIYVSVGNDSIKVVTTNLTWDDAKKNCEADKASLASLRNEWSQAYIELLVL
NLKAPVWIGLNKKQTGGYFKYIDNWHLKFASWAEDEPSSDKPCVYLDVDGQWRTAFCNQT
MNSVCMQTTEVPPTESSVFPGVCPEDTKEEYHQSYSWLPFKGYCYLFVTDEIEWANAAGS
CVRHGGVLASIEDPAEQAFIQNSLDVFHGSHSSFWIGLYKTHKGGTWQWLDKTVLDYTNW
GANEPDADYGEMVSSDGTWRSGKRWHDRAYICKTPKEFRTGRDSQGRGHTSLIVVLIIVA
VCSLAAGAFIIYKKSPRLIPTFDNPLYFESDRTQPDVVDTNRLIENAEVENTEP
Download sequence
Identical sequences H2T6P5
ENSTRUP00000020334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]