SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020335 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020335
Domain Number 1 Region: 290-424
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-39
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 880-1010
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-33
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 1164-1288
Classification Level Classification E-value
Superfamily C-type lectin-like 1.72e-31
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 4 Region: 433-564
Classification Level Classification E-value
Superfamily C-type lectin-like 9.11e-31
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 156-282
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-28
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 6 Region: 742-868
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-28
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1015-1143
Classification Level Classification E-value
Superfamily C-type lectin-like 7.96e-26
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 8 Region: 572-727
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-25
Family C-type lectin domain 0.0000896
Further Details:      
 
Domain Number 9 Region: 93-150
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000163
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 10 Region: 1-94
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000104
Family Cysteine rich domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020335   Gene: ENSTRUG00000008136   Transcript: ENSTRUT00000020420
Sequence length 1371
Comment pep:known_by_projection scaffold:FUGU4:scaffold_80:343247:357081:1 gene:ENSTRUG00000008136 transcript:ENSTRUT00000020420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWTTGDRLFATITRKCLGAQGKSLGSEVSFYDCDDKSELQKWECKNETLLALKGQQLYIE
VKPDEALSLSRTVGPNNHLTVTGMTRGACSRTYRELFTLEGNAFGKPCAFPFFYKDRWFG
ECTTYDSSTKRAWCAVGTRFENEQWGYCPTTSTDKWIKNLVTGANYQLNTQSVLTWSQAE
TSCRQQGASLLSVSDPHQQAFVSGRIPPGKQKLWIGLVLDPEHGWRWSDLKPFRYLRWSP
GNPLPNPGHNCAFLDTAGQHTWQSASCTKKLGYICYKDGAPPAPSESTENTSIEQGFCSN
PWIPYNGHCFYLNRSPQTWYNAQKECRKEGGDLVSVQNVEEQSFIISQLGFASTDELWIG
FNDIKIEGLFDWSDHSSVSFTSWTFGKPDVSTDAEDCVLITGENGNWVDRLCERKHGFIC
MKQSTTESTGDEVEVNIGCKLGWKRHGSYCYLIGTAMKTFDEAKSDCETSGSYLADVSNG
VDNAFLVSLVGLRPEKHFWLGLSNQKNIDEFVWTQGGSVKYTHWNAGMPGTEEDGCVAMR
TGPLAGLWDLLPCTNTSKYICKHLAEGAVLTAPPPTQMPLKCEQGWNRIGTRNYCVKFFT
GPRSNEKTWFEARDYCRAIGGDLLSLHNQGELLIARYVKHIFCLIVTLLRHRHGRAWIGL
HAPDPNTGYVWSWTKVNFLHWQEGEPNNHNNDESCTEFRMHNSWEESGSWNDVNCESYND
WLCQIRAGKSVNDLKDFNITSDGWLEWRGNQYYLNRNPMYMEKARHLCQQKHGDLVSISS
KEENNFLSFGIQHIARSYGSYYIGLSVDIDGRFWWMDGSSLGLQKWDENQPNPDTIDANC
VTMNYYMGYWRTCNCGQEHEFICKRSGSTPANTTAAPTVPPKGGCPLKWTKFDSKCYSII
TDQVASWEDARKQCITIGGNLVSIPTRRIQAFLTTKMAELSATNLWIGLNSLNQDGFYWT
DGKPRQYTNWGYSEDCVVMNSNAGQSIGKWLIKSCNETYGFVCTRKVDPNIPSQPDTYVP
KIYVSVGNDSIKVVTTNLTWDDAKKNCEADKASLASLRNEWSQAYIELLVLNLKAPVWIG
LNKKQTGGYFKYIDNWHLKFASWAEDEPSSDKPCVYLDVDGQWRTAFCNQTMNSVCMQTT
EVPPTESSVFPGVCPEDTKEEYHQSYSWLPFKGYCYLFVTDEIEWANAAGSCVRHGGVLA
SIEDPAEQAFIQNSLDVFHGSHSSFWIGLYKTHKGGTWQWLDKTVLDYTNWGANEPDADY
GEMVSSDGTWRSGKRWHDRAYICKTPKVPATDSDSTPGRDSQGRGHTSLIVVLIIVAVCS
LAAGAFIIYKKSPRLIPTFDNPLYFESDRTQPDVVDTNRLIENAEVENTEP
Download sequence
Identical sequences H2T6P6
ENSTRUP00000020335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]