SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020786 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020786
Domain Number 1 Region: 158-257
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.09e-31
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 291-401
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-16
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020786   Gene: ENSTRUG00000008306   Transcript: ENSTRUT00000020873
Sequence length 658
Comment pep:known_by_projection scaffold:FUGU4:scaffold_32:271788:283287:-1 gene:ENSTRUG00000008306 transcript:ENSTRUT00000020873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLDKMFGAWLGELDKLTQSLDDGRPQKALQKPPLRQETNMANFSYRFSMYNINEALNQG
DTVDLDALMADLCSIEQELNTISKPNSTSRSHNKGQQRAPGGHSASTKHTGASGGGSSGG
STNSSTRASPANTPVWKPFVEEQAAKLKAERIRVALEKIKEAQVKKLVIRVHMSDESSKT
MMVDERQTVRQVLDSLLDKSHCGYSPDWSLVETITELQMERIFEDHENLVENLLNWTRDS
HNKLMFTERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILW
LKEDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYYGQDYRSKYKAPT
DYCLALKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKKYGKQLYGNYHEAMKRTEAA
YDWSSLSTSSIRSGSSSQQPPPQPQSQPVQKHPPQPHIYNHVPLQQPQTSPPPPPPPPPP
PPPPPPAARTNVPPPPPPPPPPSMPTPGSAMGFEESPPPAPTPTPPPPPPPPPPPPPPPP
QQQQFHIPSQFPPPPAPAKMFTSGFGPHTTPKPVSPVSPFPPAPPPATLGGLTPPPPPPP
PPPAPLKKQFSLQAGHTSIQPPPTLPKQHSLSKQMTSTGGPQTMSLVKQLASQFPGAP
Download sequence
Identical sequences H2T7Z6
ENSTRUP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]