SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020832 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020832
Domain Number 1 Region: 19-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.87e-33
Family PDI-like 0.00024
Further Details:      
 
Domain Number 2 Region: 364-473
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.18e-28
Family PDI-like 0.00047
Further Details:      
 
Domain Number 3 Region: 231-362
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.51e-20
Family PDI-like 0.028
Further Details:      
 
Domain Number 4 Region: 137-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-17
Family PDI-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020832   Gene: ENSTRUG00000008326   Transcript: ENSTRUT00000020919
Sequence length 504
Comment pep:known_by_projection scaffold:FUGU4:scaffold_40:391877:395764:1 gene:ENSTRUG00000008326 transcript:ENSTRUT00000020919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEDKEPKKEKTTDIEEEKDVMVLHINNFARALEENQYLLVEFYAPWCGHCKQLEPIYAE
AAGKLKEEGSAIRLAKVDATEEKELAEKFEIAGFPSLKLFVNGDSMKPTDYNGKRTLTAI
IQWIKRQASPDVPVLDSVDAVDQFIDSHKITIVGFFEDAESEEAKVFKEVYLLNTNQEFA
ISSSPEVFQKYDIKGNALVLFKKFDEGRADFVWPEDMKLSKENITSFITNNSMELIVPFH
PENAEKIFTSNYILHCLLFFNSSVDGQVSLLEDSRPIANQFKGKILFISIDVNSTLSHVM
NYFGVSESDIPTARLINMENQKKFSINSDKLTLESILQMCEEVLGDTAKPYFKSEEIPED
WNKGPVTVLVGKNFESVALDPTKNVFVEFYAPWCGHCKELAPTWEKLGEKYADRDDIIIA
KMDAIANEVDSLVIDGFPTLKYFPAGGENSVTMEAVDYTGNRDLETLSKFLDNGGVLPEK
SGDDDDRRDESAEASTNQTTKDEL
Download sequence
Identical sequences H2T842
31033.ENSTRUP00000020832 ENSTRUP00000020832 ENSTRUP00000020832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]