SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020833 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020833
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.64e-33
Family PDI-like 0.00024
Further Details:      
 
Domain Number 2 Region: 350-459
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-28
Family PDI-like 0.00047
Further Details:      
 
Domain Number 3 Region: 217-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.78e-20
Family PDI-like 0.028
Further Details:      
 
Domain Number 4 Region: 123-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.54e-17
Family PDI-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020833   Gene: ENSTRUG00000008326   Transcript: ENSTRUT00000020920
Sequence length 498
Comment pep:known_by_projection scaffold:FUGU4:scaffold_40:391877:395468:1 gene:ENSTRUG00000008326 transcript:ENSTRUT00000020920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEEEKDVMVLHINNFARALEENQYLLVEFYAPWCGHCKQLEPIYAEAAGKLKEEGSAIRL
AKVDATEEKELAEKFEIAGFPSLKLFVNGDSMKPTDYNGKRTLTAIIQWIKRQASPDVPV
LDSVDAVDQFIDSHKITIVGFFEDAESEEAKVFKEVYLLNTNQEFAISSSPEVFQKYDIK
GNALVLFKKFDEGRADFVWPEDMKLSKENITSFITNNSMELIVPFHPENAEKIFTSNYIL
HCLLFFNSSVDGQVSLLEDSRPIANQFKGKILFISIDVNSTLSHVMNYFGVSESDIPTAR
LINMENQKKFSINSDKLTLESILQMCEEVLGDTAKPYFKSEEIPEDWNKGPVTVLVGKNF
ESVALDPTKNVFVEFYAPWCGHCKELAPTWEKLGEKYADRDDIIIAKMDAIANEVDSLVI
DGFPTLKYFPAGGENSVTMEAVDYTGNRDLETLSKFLDNGGVLPEKSDDDDDDDDDDDDN
DDDDDGDDDDDDDDDDED
Download sequence
Identical sequences H2T843
ENSTRUP00000020833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]