SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021177 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021177
Domain Number 1 Region: 323-367,731-964
Classification Level Classification E-value
Superfamily RNI-like 1.02e-41
Family 28-residue LRR 0.021
Further Details:      
 
Domain Number 2 Region: 15-84
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000264
Family Caspase recruitment domain, CARD 0.0042
Further Details:      
 
Domain Number 3 Region: 114-189
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000518
Family Caspase recruitment domain, CARD 0.0083
Further Details:      
 
Domain Number 4 Region: 267-437
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000051
Family Nucleotide and nucleoside kinases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021177   Gene: ENSTRUG00000008459   Transcript: ENSTRUT00000021265
Sequence length 1015
Comment pep:known scaffold:FUGU4:scaffold_28:611045:615599:1 gene:ENSTRUG00000008459 transcript:ENSTRUT00000021265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVQDLVLNQRTEILRVLCSSGSAEPVEHVTDILLSQGELTWEDYQSIHVSGRPLYTNAR
QLLDVVYLKGESSCGLFLEALKQVLPEEQPAGFSFPDHWWDPEVREECQNTFCQTLLTQR
PSLVSTLQHCVDGALEALLTSAHFTSADCEGIRLPLRTPSQQARCLLDHVRAKGEAAAKF
LLEYIQQVYSDQIFYVNCHAEFLKFQKKLRSSLSAQSCFLSTYGGTSHMSLDDIYTDGQL
ELAEACPDVHGPIGLKDITGEVGTINEEADTVLVSGEAGSGKSTLLQRLHLLWAREAALL
EYLLLFPFSCRRLNTELSELSFKELLFQHCCWPDRDQDEIFDFIQDHPHLILFTFDGLDE
LKQSFSDEHRLCCPTQRAPVHVLLFNLIQGSLLKGVRKVVTSRPSAVTPVLKKNLCKEVL
LKGFSPSGIDCFVRKHHSDPTVAAKVLQSLHTNTTLLGLCHSPVLCWIVSCCHKELLGCG
EGSPQTITDVYLTIVEHFFQHHSPLRSTGKISWHREYLDPVLRLGQLAFKGIVSTCYIFS
DKDLDPCAITKEDLSLGFLIQSKDLSVFRSKCYEFLHVTMQCFFAAVYVVVSKDLDRSTI
PKLFELKNLKETSLRTACFSACLLYQQVDECSLDKDATAVETPNLQMTATFASGLLSQRH
RSLWLHCCPATAIDRKTRQVSKCLSKGMQKHFKSIPQPVAGEKKSMHAMPGFVWLIKCIY
EMQECSIAKDAMSKLEVDHLKLTYCNIGPVECTALAFVLQHLNNPVGLQLDNNTVGDVGV
EQLLPCMHICHSLYLRNNNITDEGIHKLIAKSIQCDNFHKIALFNNRLTDACTQDFSLLL
KTKQDFISLRLGNNNITAEGAKQLAEGLRVNKSLKFLGLWGNSIGDAGAEALASALEGNT
TLVWLSHSLVGNGIGSAGACALSKVVKNNVSLEELWLTENCITRMGVECLIEALQHNANV
KSIWTVLLCIKIIGPRKPVLVAAFEMLVLDVKLRNNDLCLEEVEEMAQRESRLLF
Download sequence
Identical sequences H2T937
ENSTRUP00000021177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]