SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021180 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021180
Domain Number 1 Region: 361-405,769-1019
Classification Level Classification E-value
Superfamily RNI-like 2.92e-43
Family 28-residue LRR 0.021
Further Details:      
 
Domain Number 2 Region: 33-102
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000268
Family Caspase recruitment domain, CARD 0.0042
Further Details:      
 
Domain Number 3 Region: 132-205
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000151
Family Caspase recruitment domain, CARD 0.0083
Further Details:      
 
Domain Number 4 Region: 305-475
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000544
Family Nucleotide and nucleoside kinases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021180   Gene: ENSTRUG00000008459   Transcript: ENSTRUT00000021268
Sequence length 1025
Comment pep:known scaffold:FUGU4:scaffold_28:611045:615599:1 gene:ENSTRUG00000008459 transcript:ENSTRUT00000021268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVAGVQVKPSLYGNGKSMRVQDLVLNQRTEILRVLCSSGSAEPVEHVTDILLSQGELTW
EDYQSIHVSGRPLYTNARQLLDVVYLKGESSCGLFLEALKQVLPEEQPAGFSFPDHWWDP
EVREECQNTFCQTLLTQRPSLVSTLQHCVDGALEALLTSAHFTSADCEGIRLPLRTPSQQ
ARCLLDHVRAKGEAAAKFLLEYIQQGEESGSILNKKTQTVSRALPETHIREKQLVYSDQI
FYFQKKLRSSLSAQSCFLSTYGGTSHMSLDDIYTDGQLELAEACPDVHGPIGLKDITGEV
GTINEEADTVLVSGEAGSGKSTLLQRLHLLWAREAALLEYLLLFPFSCRRLNTELSELSF
KELLFQHCCWPDRDQDEIFDFIQDHPHLILFTFDGLDELKQSFSDEHRLCCPTQRAPVHV
LLFNLIQGSLLKGVRKVVTSRPSAVTPVLKKNLCKEVLLKGFSPSGIDCFVRKHHSDPTV
AAKVLQSLHTNTTLLGLCHSPVLCWIVSCCHKELLGCGEGSPQTITDVYLTIVEHFFQHH
SPLRSTGKISWHREYLDPVLRLGQLAFKGIVSTCYIFSDKDLDPCAITKEDLSLGFLIQS
KDLSVFRSKCYEFLHVTMQCFFAAVYVVVSKDLDRSTIPKLFELKNLKETSLRTACFSAC
LLYQQVDECSLDKDATAVETPNLQMTATFASGLLSQRHRSLWLHCCPATAIDRKTRQVSK
CLSKGMQKHFKSIPQPVAGEKKSMHAMPGFVWLIKCIYEMQECSIAKDAMSKLEVDHLKL
TYCNIGPVECTALAFVLQHLNNPVGLQLDNNTVGDVGVEQLLPCMHICHSLYLRNNNITD
EGIHKLIAKSLNISIVFLCSLFNNRLTDACTQDFSLLLKTKQDFISLRLGNNNITAEGAK
QLAEGLRVNKSLKFLGLWGNSIGDAGAEALASALEGNTTLVWLSHSLVGNGIGSAGACAL
SKVVKNNVSLEELWLTENCITRMGVECLIEALQHNANVKSIWLRNNDLCLEEVEEMAQRE
SRLLF
Download sequence
Identical sequences H2T940
ENSTRUP00000021180 31033.ENSTRUP00000021180 ENSTRUP00000021180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]