SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021181 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021181
Domain Number 1 Region: 327-371,729-978
Classification Level Classification E-value
Superfamily RNI-like 2.35e-45
Family 28-residue LRR 0.022
Further Details:      
 
Domain Number 2 Region: 15-84
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000254
Family Caspase recruitment domain, CARD 0.0042
Further Details:      
 
Domain Number 3 Region: 114-187
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000141
Family Caspase recruitment domain, CARD 0.0083
Further Details:      
 
Domain Number 4 Region: 271-441
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000521
Family Nucleotide and nucleoside kinases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021181   Gene: ENSTRUG00000008459   Transcript: ENSTRUT00000021269
Sequence length 985
Comment pep:known scaffold:FUGU4:scaffold_28:611045:615599:1 gene:ENSTRUG00000008459 transcript:ENSTRUT00000021269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVQDLVLNQRTEILRVLCSSGSAEPVEHVTDILLSQGELTWEDYQSIHVSGRPLYTNAR
QLLDVVYLKGESSCGLFLEALKQVLPEEQPAGFSFPDHWWDPEVREECQNTFCQTLLTQR
PSLVSTLQHCVDGALEALLTSAHFTSADCEGIRLPLRTPSQQARCLLDHVRAKGEAAAKF
LLEYIQQGEESGSILNKKTQTVSREFLKFQKKLRSSLSAQSCFLSTYGGTSHMSLDDIYT
DGQLELAEACPDVHGPIGLKDITGEVGTINEEADTVLVSGEAGSGKSTLLQRLHLLWARE
AALLEYLLLFPFSCRRLNTELSELSFKELLFQHCCWPDRDQDEIFDFIQDHPHLILFTFD
GLDELKQSFSDEHRLCCPTQRAPVHVLLFNLIQGSLLKGVRKVVTSRPSAVTPVLKKNLC
KEVLLKGFSPSGIDCFVRKHHSDPTVAAKVLQSLHTNTTLLGLCHSPVLCWIVSCCHKEL
LGCGEGSPQTITDVYLTIVEHFFQHHSPLRSTGKISWHREYLDPVLRLGQLAFKGIVSTC
YIFSDKDLDPCAITKEDLSLGFLIQSKDLSVFRSKCYEFLHVTMQCFFAAVYVVVSKDLD
RSTIPKLFELKNLKETSLRTACFSACLLYQQDKDATAVETPNLQMTATFASGLLSQRHRS
LWLHCCPATAIDRKTRQVSKCLSKGMQKHFKSIPQPVAGEKKSMHAMPGFVWLIKCIYEM
QECSIAKDAMSKLEVDHLKLTYCNIGPVECTALAFVLQHLNNPVGLQLDNNTVGDVGVEQ
LLPCMHICHSLYLRNNNITDEGIHKLIAKSIQCDNFHKIALFNNRLTDACTQDFSLLLKT
KQDFISLRLGNNNITAEGAKQLAEGLRVNKSLKFLGLWGNSIGDAGAEALASALEGNTTL
VWLSHSLVGNGIGSAGACALSKVVKNNVSLEELWLTENCITRMGVECLIEALQHNANVKS
IWLRNNDLCLEEVEEMAQRESRLLF
Download sequence
Identical sequences H2T941
ENSTRUP00000021181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]