SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021186 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021186
Domain Number 1 Region: 381-600
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.11e-68
Family Nuclear receptor ligand-binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 118-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.54e-29
Family Nuclear receptor 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021186   Gene: ENSTRUG00000008460   Transcript: ENSTRUT00000021274
Sequence length 602
Comment pep:known_by_projection scaffold:FUGU4:scaffold_61:413530:416207:-1 gene:ENSTRUG00000008460 transcript:ENSTRUT00000021274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAVFDCCRSPGGVIAYISSSSSGSSPESCHSDSSNGSYQSSSSPRGSSPSRHQQGQPADP
ALPVRCQNLPGTQKGGRASSTAKSGITNLGCDWHGTEDHRFGRSLKVFVLSSEINGLVLL
CKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNESCPIMRINRNRCQQCRFK
KCLMVGMSRDSVRFGRIPKREKQRMLLEMQSAMNNMMNNSQLQAPPVDASLSAGVAAPAA
QVVGSAPSRSPSSASESSSDPEPAVAMDTSPSSSSPSASDSSEEEVIGSVTRAHQETFMY
NQERSSLANEALPPTGPAHINKEEEQQNAWNHHNNLVTMAAQEPPNSQGCLPEEDNSMKH
CPFRMARAVDASHTPTYAHGALRAPPATCPTSRGSQWRGGNRMYLVCPMNMSAYVDPQKS
GHEVWEEFSHSFTPAVREVVEFAKKIPGFRDLSQHDQVSLLKAGTFEVLVVRFASLFDVK
NRTVTFLGGKKYSLEALRAMGAGDLLNSMFDFSEKLMNLGLSEEEMSLFTAVVLVSADRS
GIENVNSVEALQETLIRALRSLITKNHPNESAIFTKLLLKLPDLRSLNNMHSEQLLAFKV
HS
Download sequence
Identical sequences H2T946
ENSTRUP00000021186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]