SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021452 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021452
Domain Number 1 Region: 127-204
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 878-940
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000419
Family SAM (sterile alpha motif) domain 0.0098
Further Details:      
 
Domain Number 3 Region: 282-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000127
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000021452
Domain Number - Region: 78-127
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021452   Gene: ENSTRUG00000008560   Transcript: ENSTRUT00000021540
Sequence length 975
Comment pep:known_by_projection scaffold:FUGU4:scaffold_121:330333:363966:1 gene:ENSTRUG00000008560 transcript:ENSTRUT00000021540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQCDSLSGYLPQSDHGSNSECSADSPLPGSEEDLSGPQPLPDPEWTEERFRVDRKKLE
IMLLAASEGRVNGGEDFFQKIMDETQTQIAWPSKLKIGAKSKKDPHIKVCGKRENVRDAK
NRIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKRVMEETGCHIHFPDSNRNNQAEK
SNQVSIAGQPGGVEAARVKIRELLPLVLSFELPAIMQSDPSSPTVQHISQTYNLTVSFKP
PTRLYRASGVVRGSQNNTNAVKRGTALLLEHLVGSLASTISVSTHLDIAPQHHLFMKGRN
GSNIKHITQRTGAQIHFPDPNSPQKKSTVYIQGTIESVCLARQYLMGCLPLVLMFDIKED
VEVEPRCITALMEQLDIFISIKPKPKQPSKSVIVKSVERNAVNMYEARKFLLGLESNGVS
SSSPPVVLNPTPNGPSPSLICPVGLDILASAGLGLSSLGFLGTTTPHTLNSAPPNAVLNS
LNSAMSPLHPPTNPTPPGSLWPSALASTQGFSSQLLLHPATQATLSSILLPGVQGYTQSA
PSPPPGLAPIDKQPSSVPDCSSSCTLNGHVTHAGSIYRRRPTGSLGESVLTPTPCDSVQE
ASGHNPSEPLSTKSNPHEGSSDTFVEVGMPRSPSHSANGSELKQMLASCKTSSGKRQAVE
LLQGTKNSHLHSSDCLLSDAESSSSDSPVADKRAPGSERAAERAAQQNERERIRLGPQTT
FANIQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANHVS
YKPSMSTTYEGSPLSLSRSSSREGIGNGSDSDNWRDRNGAGNGLSSHAEFVSSPKRKQNK
SGWTAAEHYLSSSSNYMDCISSLNGSNGCSLNSSLKGSDLPELFSNLGLGKYTDVFQQQE
IDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRRKLFEPPIRSSFLEGGASGRL
SRQFHTDVASISGRW
Download sequence
Identical sequences H2T9W2
ENSTRUP00000021452 ENSTRUP00000021452 31033.ENSTRUP00000021452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]