SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021477 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021477
Domain Number 1 Region: 203-335
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.33e-21
Family PDI-like 0.05
Further Details:      
 
Domain Number 2 Region: 338-442
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.46e-19
Family PDI-like 0.0036
Further Details:      
 
Domain Number 3 Region: 1-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000847
Family PDI-like 0.0015
Further Details:      
 
Domain Number 4 Region: 114-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000636
Family PDI-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021477   Gene: ENSTRUG00000008569   Transcript: ENSTRUT00000021565
Sequence length 473
Comment pep:known_by_projection scaffold:FUGU4:scaffold_40:399423:403024:1 gene:ENSTRUG00000008569 transcript:ENSTRUT00000021565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQLNSGNFDRALREHEQLLVHFYVPLSGQGHQVSAAFEGAAVELQGSEVKLAVVDAAKE
KDLAKELNVAGSSEIRLYVSGDKHSPVVCPVPQSSTSILTWLRRRAGSAGDLVRDLSQLE
ASEDVTVVGFFRELNQEYVQTFYATAIQLPDVSFAITQDNEVTHKYGLTYDVVFLLRKSK
LIQAYKLIPQTSKEELMVFISVYQMDPVTEYTGKTANQILSSPVLNHALLFIRKSSADFN
HVYSAFNNAAQSFRVKILFVWVNVDEPRNGRLMEYFRVRDFEAPLIRVVNLTSHVTYQLP
SDTLEVETIKTFCASYLEGKAKPKMQSEAIPEGWDTQPVKELVGMNLEEVAFNPNKTVFV
MFYLPYSPASRALFPLWEELAEATEGREGVVIARIDASANDINLSPQGAYPTLCLFPALH
AERMVVYSGERRLGDLIQFLNTEMEKAKRDRVQEDEDRRKYIKDIKDEEAKKA
Download sequence
Identical sequences H2T9Y7
31033.ENSTRUP00000021477 ENSTRUP00000021477 ENSTRUP00000021477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]