SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021502 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021502
Domain Number 1 Region: 1137-1333
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.04e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000288
Further Details:      
 
Domain Number 2 Region: 918-1043
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-27
Family Pleckstrin-homology domain (PH domain) 0.0000126
Further Details:      
 
Domain Number 3 Region: 49-173
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-19
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021502   Gene: ENSTRUG00000008576   Transcript: ENSTRUT00000021590
Sequence length 1856
Comment pep:known_by_projection scaffold:FUGU4:scaffold_204:284090:301630:-1 gene:ENSTRUG00000008576 transcript:ENSTRUT00000021590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARSFNQKKDEDGWNKHLCITSNVLFVHLFQAKQKDGRDQSETAATASPGPEEEPFSWPG
PKTLRLRRTSQGFGFTLRHFIVYPPESAVHNSLKDEENGSRAGRPRNRLEPMDTIFVKQV
KEGGPAHRAGLCTGDRIVKVNGESIIGKTYSQVIALIQNSDASLELCVMPKDEDILQLAY
SQDAYLKGNEAYSGNAQNIPEPPPICYPRIEVKAAGMAQMSESGAVREMLPASAQGPGRQ
GGAAEKSYRVEIPVPPSPTASQQTLKSQGAVCVCSENSRTAPVSMDPVERGPRVARAGPS
HRTEENRYSPPAASVKSKPFIPSVPGGAQLQHPSSHPTESPVFYPSSSLRTGSIFSDRLS
SPVRSSINPASPDAFSNDLNHYSPSPPSTSQHQNIDWKNYTTYKDYIDAKRLHTYGCRTI
QERLDSLRAASSSSSAYSQQRTPPPPSSSPRGAPESQVKRRSTSTDRGVETSGRSTARAP
LRSASQERLWGGTERTVPVRNWPRSASEDALPFSSPVGFAKPRARSCDYLGKQPGEAGVA
SGGDRAGFEDRLRLFRGEEARVPRQGATVTALPYLNRNLPGKEEEGQGSVLPYSPVAAPV
FTKGKTDSRTDCVILRPSRLPVKNSISAPSTILSTVKTTEPLKDQRANIIGNHISYPSPL
HLQLRGRADSLKMESRAEVGLTARSSSCSGPSSKLPMQRHSEGVAALSSFGSTAINGDVN
QKPTGVEGPDATIVVLRRDKNYGPPLVRPPPYVLALDAGSLDGAMCWMSDSCRERHHRRL
GDTRHKSKHLDDSLDSIPFIDEPSSPSVDLDSSPIPASAVISGAPTVTTIPPSPTSPSSL
IRRQLSHDHDSIRLTIIESDSGTKTERSKSYDEGLDNYREEGRGSLIPGLKSLRKVDRSS
EDSGSRGDSSSDVFCDATKEGPLQFKQLSADKNKRVGGGMRPWKQMYAVLRGHYLCLYKD
RREGHAHANCQTVEEPLPISIRSCLIDISYSDTKRKNVLRLTTSDCEYLFQAEDREDMLA
WIRVIQENGNLDEENAAFTSHDLISRKIREYKTLTSPTSSKTEPSPKSSRQSLSIKHTLL
GGKGEPKATSPHSKPEQDRKNLHKDDTSPPKDKGTWRKGIPGLMRKPFEKKPSPGVTFGV
RLDDCPPAQNNKFVPLIVEVCCNLVEERGLEYTGIYRVPGNNAAISNMQEELNNKGMNDI
DPRDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRTEDPVERLKVLKRLLHEL
PAHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTTDDNMTHMVTHMPDQYR
IVETLIQNYDWFFTEEGNGEPVTVSREESAVESQPVPNIDHLLTNIGRTGTSQGEVSDSP
TSDSAKSKGSWGSAKDPCTRDLLVSSIFAAASRKRRKSKEKPQPSSSDDDLDSVFLKKEI
PGQKANTHHLLQTEAQSRLGPKTTLPARAEERKENGKTVELAPKAKREHRKSIFLKGTTP
PRHPSPCPSPNIYQSVPQGKSSSSDPPSQFDENTSDLGTMSSGASVPRSRPKKWSAGMSA
DLPAGAAPGSGGSAGAEVSSITSDYSTTSSITFLTGAESGALSPELHGGEEADDERSELI
SEGRPMETDSESDFPVFAPDGGNSHSTPRLGQSLEKSELQGEAQGGTAGKLEARRLFPTQ
RMIECDTLSRRWSLRQKTDSESSVEGLTGGGEGNEAKESSTRLSRVLGVIKKGRPTSSVS
SSPRSEPERHEAAWHLRISERLKFRLRTSADDMFTQKNRTPDARGKKKNIRRRHTMGGQR
DFAELAIINDWREQGGVDQTADLSALDRLKPRCSSQDFSIRDWISRDRCRDSVSSV
Download sequence
Identical sequences H2TA12
ENSTRUP00000021502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]