SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021654 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021654
Domain Number 1 Region: 146-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-99
Family Protein kinases, catalytic subunit 0.0000000000465
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-24
Family Pleckstrin-homology domain (PH domain) 0.000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021654   Gene: ENSTRUG00000008633   Transcript: ENSTRUT00000021742
Sequence length 482
Comment pep:known_by_projection scaffold:FUGU4:scaffold_455:111496:116438:1 gene:ENSTRUG00000008633 transcript:ENSTRUT00000021742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVTIVKEGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQTSPPLNNFSVAEC
QLMKTERPKTNTFVIQCLQWTTVIERTFHVDSNEDREEWMWAIQSVANSLKMQEQNEEEP
MDLLGSPNECSLEDMEVAGSKGCARVTMNDFEYLKLLGKGTFGKVILVKEKATGVHYAMK
ILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHM
SRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFEL
ILMEEIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPDDAKEVMTHKFFTNINWQDVVQKK
LTPLFKPQVTSETDTRYFDEEFTAQTITLTPPDKCKDNSLDSEDPGQPAHFPQFSYSASI
RE
Download sequence
Identical sequences H2TAG4
31033.ENSTRUP00000021654 ENSTRUP00000021654 ENSTRUP00000021654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]