SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021862 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021862
Domain Number 1 Region: 33-487
Classification Level Classification E-value
Superfamily Sema domain 9.42e-74
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1323-1451,1610-1767
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-42
Family p120GAP domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 490-539
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000126
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 813-917
Classification Level Classification E-value
Superfamily E set domains 0.0000000000202
Family Other IPT/TIG domains 0.0072
Further Details:      
 
Domain Number 5 Region: 914-981
Classification Level Classification E-value
Superfamily E set domains 0.00000318
Family Other IPT/TIG domains 0.063
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000021862
Domain Number - Region: 1009-1050
Classification Level Classification E-value
Superfamily E set domains 0.000191
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 776-808
Classification Level Classification E-value
Superfamily Plexin repeat 0.0837
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021862   Gene: ENSTRUG00000008707   Transcript: ENSTRUT00000021951
Sequence length 1826
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:244039:268776:-1 gene:ENSTRUG00000008707 transcript:ENSTRUT00000021951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQPERADKKFGFPSLASLLDSGIPLRMQGQMSVWLIEFLSDTLINNVVADPRTGFLYVGA
VNSLYQLSPDLEVQSRDETGPKRDSRLCTPPITEACEEAVDTDNHNKLLLVHPAENTLVV
CGSIFRGICSLRNLSSVEDLLYYSDTKGEKSYVASTEESVSVVGVMSQYGKVGDSLPVFL
VRTYGTFFPCPVIQANISFSRVLEFSSLSSDFCHLFCYRSEKVTAATTALSIIEAAGVQS
NPFVLRYLHDFRFAFKDGHHVYFLFSRTLGIQDTKNYTFISRMCENDLGYFSYTELQLNC
STTNKLTVTPVTFNSDILRISVSTGLSGMRSVCRMAEPSRMYPLRFINEKLVKIIEACYS
GKGVIDGKPSVYLPYLSNPDDCGAEFLPSPLASKAGFALKAEPLLERKGQLTAVAVAVEM
EHTVAFVGSATGEVMLISLHLSFVAQLQTDFSILFCYLQHKVISFDPLQNICLHYLLTSH
PITKVPVQTCHLKTDCQSCMSLKDPYCGWCVLEGKCTRKQECSRSSGSNAWLWSPDQKCV
EIQSFNPPNLSCKKKDQVDIIIPKHPELGSSDKLYCVFENLTTEALFDGKTLVTCSLPDP
VEIPPTPDQQDYVSVPVKILVNKNIEVTSGEYHFYNCAATGTLKITAAVTEKMLWMLPGQ
EPGHLQGETSQSQSLSSSSSSSFIHRLWLIHRNIVPLQGRKFTIGTELMKNIEREVTQEQ
GSKFTFSGYKVSIGHHFAYDKQQEVNISFHIKEKDTDRKIDSTLRVGLYNCSVGREDCSL
CRHADATYQCVWCTATHMCVYQELCRLSAPAQCPKPEITDIIPRFGPLNGRISVTIKGSN
MGIKKEDIKKITVAGVDCAHQEDRYSVSTSVVCEIGPAKRVPPSDLPFEPTHAGVVEVEV
EGGRHGRSQVIFTYRDPKPVAVHPAKGPAAGGTVITITGEDLDTATKEDVTVTMTYLLSL
SFRLSFGVLITCKTGKYRGQKLPSDLMTVTVKYGENTTKDILSAYQYSENPKVTDYNPKA
SFLCGGRKIVVTGNGFDLIQRATIKVLPSTGLGDTTLPVLYSTSLLFPLQFVEEARSKND
TVLQFDSPAVNSSCKALRTFLQLDNVVEKLKSFDYHPDPSXNELLKKGHKEDKLILEAPS
PQPKSRSKRPRRDTTNEMLELVHKKLYVYRCVLASWNIHSIPLQVKFGHGEWLVGSVCYA
RKDDIPLAIIIPAVIIPMIIFIAVSVYCYRRKSQQAEREYEKVKHQLENLEESVRDRCKK
EFTDLMIEMEDHTNDLSEARMPFLDYKTYTDCNFFLPSKDGANDAMITRKLQIPEARRAI
VAQALNQFSNLLNSKTFLINFIHTLESRPDFNARARGYFASLLTVALHGKLEYYTDIMRT
LLLELMDEHVQNKNPKLMLRRSETVVDRMLYNWMSICLYQFLRDTAGEPLYKLFKALKHQ
VEKGPVDAKMKKAKYTLNDTGLLGDDVEYSVLVLVHGEGPDVTPVKVLSCDTITQVKEKI
IDQVYRNLPYSQRPKVESVALEWRPGSTGQILSDLDLTAQKEGRWKKLNTLAHYNFSHTS
SLSLCVMLTENSLLEEDNTFHLVRPADDIDEVKSKRGSMKDKAMTKAITEIYLTRLLSVK
GTLQQFVDDFFRSVLCSNSIVPPAVKYFFDFLDEQALKHDNVDEETLHIWKTNSLPLRFW
VNILRNPHFIFDVHVTEVVEASLYVISQTLMDACTKTEHKLSRESPSNKLLYAKEISSYK
KMVDDYCKGIRQMVPVSDQDMNTHLAELSRQHTDKLNTQVALHQLYQYASKYYDVIIQSL
DEDPAAQNKQLTLRLQQIAAALENKV
Download sequence
Identical sequences H2TB22
ENSTRUP00000021862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]