SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024102 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024102
Domain Number 1 Region: 687-882
Classification Level Classification E-value
Superfamily Sec7 domain 4.97e-76
Family Sec7 domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 318-331,444-627,1184-1532
Classification Level Classification E-value
Superfamily ARM repeat 1.41e-28
Family Armadillo repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024102   Gene: ENSTRUG00000009591   Transcript: ENSTRUT00000024201
Sequence length 1845
Comment pep:known_by_projection scaffold:FUGU4:scaffold_95:480157:505168:-1 gene:ENSTRUG00000009591 transcript:ENSTRUT00000024201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKEESKKLSPPSGDGKS
SSSTLPPIKSKTNFIEADKYFLPFELACQSKCPRIVITSLDCLQKLIAYGHLTGSAPDST
APGKKLIDRIIETICACFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQLERDRHRQHSPVTQHTVTESP
TLHINPPTKGVSQEANGSITPSTPQEQRPVYENPDPENGSQYCVPENEQTEADQATAAAV
TLAARETDEDENTPNYEEKAQEIVQSILQDVVNTVAGEAEAEPAEATTEGMQNCIEDEGA
LGSDGEHVHANGIPGTPISATFTPSLPDDRLSVSSNDTQESGVAPGQPPGAKFSHILQKD
AFLVFRSLCKLSMKPLSDGPPDPKSHELRSKVLSLQLLLSILQNAGPIFKTNEMFINAIK
QYLCVALSKNGVSSVPEVFELSLSIFLTLLSHFKTHLKMQIEVFFKEIFLYILETSTSSY
EHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRAGHELGTTP
LQELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEKPSEQENSDTKAPETINRY
GSINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQE
QGMLGTTPEDLAQFLHQEERLDSTQVGEFLGDNDRFNKEVMYAYVDQMDFQGKDFVSALR
MFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQ
VKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAMKETKELTMKSNKQSVASE
KQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGL
QDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTASSGITEMKQKNID
TIKTLITVAHTDGNYLGNSWHEIMKCISQLELAQLIGTGVKARYISGTVRGKEGFITSTK
EQNNDEYLGLGRVGGTVDRKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFV
RWLCAVSMDELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNSNE
DVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVVRCIAQMV
NSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNVFEKHFAATIDSFQDAV
KCLSEFACNASFPDTSMEAIRLIRHCAKYVSDRPQAFKDYTSDDMNVATEDRVWVRGWFP
ILFELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWWQDLFRIVFRIFDNMKLPEQQ
TEKAEWMTTTCNHALYAICDVFTQYFEALNDVLLDDILAQLYWCVQQDNEQLARSGTNCL
ENVVILNGEKFLLETWDKTCNCMLDIFKTTIPHALLTWRPIGADGEHMTTLSDKQLDSIS
QKSLDIQSRSADRFTTENHRQSQFISASGIGEDNSRSRTPTKVQEQRLFAALLIKCVVQL
ELIQTIDNIVFFPATSKKEDAENFAAAQRDASNPADLPAETQDQGMYRYLTSQQLFKLLD
CLLESHRFAKAFNSNNEQRTLLWKAGFKGKSKPNLLKQETSSLACGLRILFRMYMDESRQ
DAWEEVQRRLLNVCSEAVAYFLALTSESHREAWTNLLLLFLTKVLKISDERFKAHASRYY
PLLCEIMQFDLIPELRAVLRKFYLRIGQVFHIAQLPEAEQDLQPA
Download sequence
Identical sequences H2THF2
ENSTRUP00000024102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]