SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024465 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024465
Domain Number 1 Region: 246-358
Classification Level Classification E-value
Superfamily Caspase-like 1.94e-32
Family Caspase catalytic domain 0.00016
Further Details:      
 
Domain Number 2 Region: 97-182
Classification Level Classification E-value
Superfamily DEATH domain 5.3e-17
Family DEATH effector domain, DED 0.016
Further Details:      
 
Domain Number 3 Region: 9-86
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000918
Family DEATH effector domain, DED 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024465   Gene: ENSTRUG00000009742   Transcript: ENSTRUT00000024564
Sequence length 358
Comment pep:known_by_projection scaffold:FUGU4:scaffold_263:348859:351125:1 gene:ENSTRUG00000009742 transcript:ENSTRUT00000024564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGGSVMDLRLLSQIDAQLDSLEVAALCFLCRDAVSPKSREGITDARGLFKKLHEKRLLEN
SSFLSQLLHTIHRKDLLCLLEADSSQPEETDARPLLSEYRVMLYKLYENLDREDLKKLKF
LLSDQLGRRQIELCKTVLDVFTEMEKKGLLSNTKLDKLHSVLKEVDQRLAATVHDFMQPL
RDCNHNHTFITVFEWKQSSECTIFSRSPGAWNTTPRCYEHGNTHRCSFLSSVQSFGIFIT
IHLLNEYYALIHNPRGLCVVFNILCDAERLRSVFTKFGFTVQVHNDFTAEAILRELKRLG
KRDFMNEDALVVCVLSHGLKGCIFGTDGEEVSLQDFTQPFVSSQAPTLAGKPKLFFIQ
Download sequence
Identical sequences H2TIG3
ENSTRUP00000024465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]