SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024469 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024469
Domain Number 1 Region: 217-475
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-71
Family Caspase catalytic domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 92-183
Classification Level Classification E-value
Superfamily DEATH domain 1.06e-17
Family DEATH effector domain, DED 0.016
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000153
Family DEATH effector domain, DED 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024469   Gene: ENSTRUG00000009742   Transcript: ENSTRUT00000024568
Sequence length 478
Comment pep:known_by_projection scaffold:FUGU4:scaffold_263:348874:351587:1 gene:ENSTRUG00000009742 transcript:ENSTRUT00000024568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRLLSQIDAQLDSLEVAALCFLCRDAVSPKSREGITDARGLFKKLHEKRLLENSSFLS
QLLHTIHRKDLLCLLEADSSQPEETDARPLLSEYRVMLYKLYENLDREDLKKLKFLLSDQ
LGRRQIELCKTVLDVFTEMEKKGLLSNTKLDKLHSVLKEVDQRLAATVHDFMQPLRGTEQ
NVSPDAESIFQSSPPADDVKHSQMLVPVLRSVIRDLYYHPSFNEYYALIHNPRGLCVVFN
NETFLPGANLPRRGGTMEDQKRLRSVFTKFGFTVQVHNDFTAEAILRELKRLGKRDFMNE
DALVVCVLSHGLKGCIFGTDGEEVSLQDFTQPFVSSQAPTLAGKPKLFFIQACQGEKLQK
GYAAWPPRPEQEMAKAESQLEEDAGPVKAKVVADSADFLIGMATVEDYKSFRNTKNGSIY
IQELCNQLQKSAESPGHDHILDILTRVNREVSEGEFLNHKQMPEPKYTLTKKLVLKYL
Download sequence
Identical sequences H2TIG7
ENSTRUP00000024469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]