SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024471 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024471
Domain Number 1 Region: 215-469
Classification Level Classification E-value
Superfamily Caspase-like 1e-68
Family Caspase catalytic domain 0.00000379
Further Details:      
 
Domain Number 2 Region: 92-174
Classification Level Classification E-value
Superfamily DEATH domain 3.83e-17
Family DEATH effector domain, DED 0.016
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000141
Family DEATH effector domain, DED 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024471   Gene: ENSTRUG00000009742   Transcript: ENSTRUT00000024570
Sequence length 471
Comment pep:known_by_projection scaffold:FUGU4:scaffold_263:348874:351581:1 gene:ENSTRUG00000009742 transcript:ENSTRUT00000024570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRLLSQIDAQLDSLEVAALCFLCRDAVSPKSREGITDARGLFKKLHEKRLLENSSFLS
QLLHTIHRKDLLCLLEADSSQPEETDARPLLSEYRVMLYKLYENLDREDLKKLKFLLSDQ
LGRRQIELCKTVLDVFTEMEKKGLLSNTKLDKLHSVLKEVDQRLAATVHDFMQPLRVVPR
GPGTPPPAVMSMVSTEQNVSPDAESIFQSSPPADDNEYYALIHNPRGLCVVFNNETFLPG
ANLPRRGGTMEDQILCDAERLRSVFTKFGFTVQVHNDFTAEAILRELKRLGKRDFMNEDA
LVVCVLSHGLKGCIFGTDGEEVSLQDFTQPFVSSQAPTLAGKPKLFFIQACQGEKLQKGY
AAWPPRPEQEMAKAESQLEEDAGPVKAKVVADSADFLIGMATVEDYKSFRNTKNGSIYIQ
ELCNQLQNPGHDHILDILTRVNREVSEGEFLNHKQMPEPKYTLTKKLVLKY
Download sequence
Identical sequences H2TIG9
ENSTRUP00000024471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]