SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024665 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024665
Domain Number 1 Region: 3081-3132
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000287
Family RING finger domain, C3HC4 0.0067
Further Details:      
 
Domain Number 2 Region: 1874-2115
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000182
Family Extended AAA-ATPase domain 0.045
Further Details:      
 
Domain Number 3 Region: 1521-1650,1718-1776
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000432
Family Extended AAA-ATPase domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024665   Gene: ENSTRUG00000009816   Transcript: ENSTRUT00000024765
Sequence length 4282
Comment pep:known_by_projection scaffold:FUGU4:scaffold_115:580100:598426:-1 gene:ENSTRUG00000009816 transcript:ENSTRUT00000024765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVELLDKLCRGVKPESYNQNYPDVPLTCMNILALVTDFVHRNAPKSPEGKAKQQNVNDC
VSKAKSIIRNWMARSFKQNLLSKGFFSSASADVEESARKQIEYYCSKIESLENSAPWVAA
IIEKCALEAVPSLCQNKNEGQILERIKVNWKFVGLISAIIEKSWPSETPHHDDGMVLQHL
LSWTAAKHIFQLYGAEENVLAKLSEEAKKKMDAAISALVAISDDLADGNIKIALLNVILE
KKEAYLDLLKIAADCFPGIECYQNKDKMKRLMECRQTEVKAVYHEKELFNILLTMTLKLE
DHMTVSVDEMVERQQVVIESKCLRDFMKVHQVDHLPTDNTGVVTYFQLDRKIRDMAKDLY
TFQGSHLFNVCWEKVAKQVAAEEMKANNSEDEEVANMKATSKKIRKRIFQPAYFKYQSIY
ELLKGGQIKLKDINQLFGTFKGNYEGLTRELLIMNRIEEKSDEQWIHSRVQQIEQYHELH
LAVASAEMIMMVKETLCLQGDFRVLETLREVNHVDFPNEQLNRIDNNLMKAKKILVDINE
PRRLCLEELGLRRHFVKWVKDALEDINELKVFVDLASISAGENDMDVDRVACFHDAVLGY
SSMLYELKPDSDFHVFQEVVKKLWRALENDPNLPKKLRDTARHLEWLKTVKDSHGSVELS
SLSLASAINNKGIYLISAPREKRVSLDTVLKLQILEENDEGQQMRCYSLEDLRELQNKLM
LMSGKGDQGQNEVDHFAEVFDGVQRLCETFITLYTAGNPLVQHWEARIRCCLNSQEPSIV
MDFHLDNVDSVVLEGSIDTQLTELCRKMEKGLKDWAGFVREQRLQYYYLNCYTAEQIVYL
CSKLSQQNVSDVEDQVLMMLSLVKPDCTASDLRQVKHTLQYELLTKPEEENDVVEPENDL
DPCVDSAVQKFDQIWDAYMADMKNFLPHILDIKSLGRLLQLLADKASESDVTVGLVNRQL
PKGLVPGNPNLIVCPHSDILTACLSIYMSSEDQPLPTYDEVLLCTPSTPYEQVEIFLRRC
LSTGYEGQKIYSLLFGDLLTYDVSSKVEKFFQQMKMQSRKDYRLVIICSTEREHSYIPSA
FSQNRVHVIPQESVERLRQYLHRHFVVPQNRSSAAAAFKDRLCVGVVSSQRAGVGKSLYI
KRLYERLKHSAESSVLKCIRLINPVIDEDDVLRSLLTTPTWTEPVLFHFDVTSSVRKGLH
EFLFKLLILRYLMDSEGKMWKCRDNQLYLIEVLQPTAQTGKIFFNMFPFIFCRPPNKVVN
HEMGKRDDLTDGNGDDPLMDDQIFRSEAFQRPYQYLQRFHNHCDLDSFRFKGVEGSHVEC
LQIFLLYCGVSDPSWAELRNFVWFLNHQLRDCETSVFCDPAVTGDLLTGFKTFVVDFMIL
MAKDFATPSLSISDQSPGRLSLNLTGMRDEDLAPFQIRKRWETELHPYIFFNDDHESMTF
IGFHLQPNGQNYVDAIDPSSQRVIKKNIMTIQLYENLKLQGVPFNIDFDGLQRGEKIERL
CRVLGIQWPTDPDETYELTTDNILKMLAIHMRFRCGIPVIIMGETGCGKTRLIKFLCELQ
RSGVATDNMKLVKVHGGTTSEMIYSKVREAECMAIINNQDYNFDSVLFFDEANTTEAISS
IKEVLCDKTIRGESFTQDNRLQIIAACNPYRKHKDEMIQRLESAGLGYRVRADKTDEKLG
SIPLRQLVYRVQALPPSMIPLVWDFGQLNDQTETIYIQQIVQRVAQSNAIDRVHIKMITE
VLSASQKYMRQRCDECSFVSLRDVERCMQCFVWFIEHHVKLFAELEEYDRRQNAENNDRC
QRQPSVRDPVVWSLVMSIGVCYHACLEYKEKYRQIVSKSLPQGYNQAKVMQEISLMQDLL
LSGVPMGNTIARNSALKENVFMMVLCIELRIPLFLVGKPGSSKSLSKTLVADAMQGQAAH
SDLYKMLKQVDLVSFQCSPHSTPEGIINIFKQCGRFQKGKNLAEYTRVVVLDEIGLAEDS
PKMPLKTLHPLLEEGCIDDDPLPHKKVGFIGISNWALDPAKMNRGIFVSRGDPDEKELIE
TAKGICRSDGMILEKIRDFFQPLARAYLKICRGEGKGFFGLRDYYSLIKMIFAVARSSQR
KPTSEETVKAVLRNFSGKQSVDTVAVFTTWLPVAPSLENINAIEFVRENIQGAGHDEECR
YLLVLTRNCAALKILQQTVFSENCLPEIIFGSSFPKDQEYTQICRNINRVKICMETGQTV
VLLNLQNLYESLYDALNQYYVCLGDQKYVDLGLGSHRVKCRVHRNFRLIVIEERDVVYKQ
FPIPLINRLEKHYLDIHTVLKTEQKRMVEELEKWVALFVSVNGQNTTVTYRYQQADVFIG
YHSDMCASVVLQAIEKHKDIGDEADHDRRVLDEAKLLMLKCATPDSVVRLDCTDLPRVES
EHLATVYFQEQSSSCLADFIVSQMRQDNMCGSTFTEVTTFSRLLTVSELEPLKEMAKGVE
LLSLQQFETEHSFLKKIRTFLTSGKAGDTNRPCNKILIIQCDFDEASDSTKLIISAKHSS
FNEINKLTQQNTGSRVFVYFITRLPRMEGGTSYNGFHGGVWRAAHIDDLRRSKDMVSDIK
ALQNMTISQMFESMMSSAEAMEIESMYTEEQEEVDPEEIAVDTTALVRSCVQSAAGMLRD
QGDSGLRSAQRVEILLTLLCDHDEIKAEFLETVKAHLHSMLRTLESNTMERNWVIKEASN
FDALQEGGTFRHTLWKRVQTVVVPLLAQLVSVVDRDQNLDILFDEDCNEPVKRLWLDIFS
NDKLLEIPHLTPDHSSDRKTLLVQNSILQNKMSCSLPFSWRIRNYLEELWVLALQQEGRT
QQEFEELFWKTPLGRYVRKADLEMQVEFYQRYLQDFVCMTMNVTCPEHHELFYKALCCCV
DELRLQLHVTSPVISFTWVHAAYHHYKNRMQNLSRMICIEPQVLPHLLRNPNVTTGSELV
LDVYAALACVECLDLRQLDTDEQRQAWLQMVKKLQVPIELVCSEESLRNYGEKSQTIVRN
VQAGWSRIFSLSLFVENVLLGIDKVEKKLTPVVLEHTRQLGQILEKNSDLKTYEAFQQVI
ALLKICKEKAVDCLFRFGSGLCSICIGDPQDPLCLPCDHIYCQACLKQWLCPGQMFCPLC
TQQVNDDFQIVPSEDVRVLVNQHARFRKQCNAFFIDLVTSVCFKDNSPPCSDVIRHLLSF
LIVEGKSSHFLRAGKCKTLTKMLSPFDDSVDKNPVVRSVVLKLLLKYSFEEVRGYLQQHL
LHIEQSNILEKTDKTELYLLYINCLEDSMYERFQFRSADARQVCLQDESFFLMNYLETQS
AETATVAYLQQVARVRMDLDMAARLIVENVKPSAPNTSPNGIKAFLDSVEALCRRSGNEW
YRVYLIRKVGSQCGVDFVSKLLKVDAVQWLFPQEVLQKSNDPTRIDQYLVCGEQYQTIRN
AVAEAVMKGTMEGLDQTCESCACLPQQTTVYLLLALHREVTALLRDANDSFSLKQELLEA
LLAFIQTSKFLTNPAVKAFAEALVRNQIGPLCARPGASTSRYVLVDLTIHLAAVLLCGHQ
GVLAPLQQLAHTPANMQKAFLPSMPDDMQAAAREALGPLQWYHCPKGHPIAIGECGQPME
RSRCLDCGAAIGGTDHRPLEGFHVVNLEGDRTQTGHVLGDPSRRNNADMLDTKSLSPVPF
TVIRMLTHMALLLGARSHHQSVSAIIKPVVHDPGAFLHAHLKKDLQHLIRCLGKGTDDTI
STVHLLINSLLDPHTQQSWPVPFDNLLSTKVYRNGWEMEINNSIIAPQLKHLDRQLKEVN
ALIRADSRVSASPVMMLLGGDPRLFLASVPKDSLIHCSTVWSCREKISLQSLTHIVELNG
GKDSVPVLWTFLHKEAELRLVKHLPDILALQRNLVKSFQNVAVQTGTIREFLNTQNADGL
KAWYKKHIGIFLTTWNQLRVSLATNGEIKIPAEYCQSDMDHSSDFSFLLPRRQGPGLCST
ALISYLISLHNNMVYCMDKHMGEETSYRVSPVDLTDLHVIRYELERDLMPLILSNTQYSI
ERGQESLLEYDLAKIQQQLVSRFLLGKPLIILQGIPTLVNRYDRNYEVILRDLKAKVQQE
PLQMRTMLAVAAELQSYSEVCELSTLEVLGFLSMTSEKPHMQLSTYLEEVLQMGTQMPPH
ILKALSMCCLKHCAALWQLLSSLKSENMLQLKRDPFPGVSELYKQALGEEEHRLLTAFFS
KNSAEGFLLEMHEFLVLVLKNPNAEDTFKPEWSLAVTLFSYMERKDLDVSPEMEEFPEEL
LLAHYVEAWKFIVAFKQERQRQ
Download sequence
Identical sequences H2TJ11
ENSTRUP00000024665 ENSTRUP00000024665 31033.ENSTRUP00000024665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]