SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024699 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024699
Domain Number 1 Region: 484-596
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-31
Family SH2 domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 170-260
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-28
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 295-410
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000178
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024699   Gene: ENSTRUG00000009828   Transcript: ENSTRUT00000024800
Sequence length 600
Comment pep:known_by_projection scaffold:FUGU4:scaffold_153:587524:624409:-1 gene:ENSTRUG00000009828 transcript:ENSTRUT00000024800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAGCPDYFLHHPKYQQDNIDRSSNHRQADLIGPAFQQTAHRSSPNHQEDDVDLEALVN
DMNSSLESLYSTCSGQQTESTPLLHNGQSDGLSHVSPELPSSSSVDSPQTGLRRSQPMHI
LAVRSLQEEEQQLRTSSLPAIPNPFPELCSPASSPVLSPGSLPPGEPPADNYIVKIFSED
GMGKVVEIPADMTARDLCQLLVYKSHCVDDNSWALVEHHPLLGLERCLEEHELVVQVQAS
MNSDSRFLFRKNYAKYEFFRNPLTFFPEHMVAWCQESSRTIPPSQLLQNFLASTSCPEIQ
GYLYVKELGRKSWKKVYMFLRRSGLYCSTKGTSKEPRHLQLVADLEDSNIFTVITGKKQH
GAPTDYGFCVKPNKGRGEMKELRMFCAEDEQGRTCWMTAFRLFKYGIVLYQNYKIPQQRK
TLLSHFSAPVRSVSENSLVAMDFSGRIGRVIDNPVEAQSAAMEEGHAWRKRSQRMNILGS
HSPLHHSSLNSVIHIAQLWFHGRISREESHRIIHQQGQVDGLFLVRVSQSNPKAFVLTLC
HHQKIKHFQILPCEEDGQVFFSLDDGATKFTDLIQLVEFYQLNRGVLPCKLKHPCTAVAL
Download sequence
Identical sequences H2TJ45
ENSTRUP00000024699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]