SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025031 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025031
Domain Number 1 Region: 413-515
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 7.06e-29
Family FAD-dependent thiol oxidase 0.0031
Further Details:      
 
Domain Number 2 Region: 50-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.25e-21
Family PDI-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025031   Gene: ENSTRUG00000009955   Transcript: ENSTRUT00000025134
Sequence length 742
Comment pep:known_by_projection scaffold:FUGU4:scaffold_122:270301:287560:1 gene:ENSTRUG00000009955 transcript:ENSTRUT00000025134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWKMAQRRGGATSRCAGGTQTHRRRTRATTAVWLLTYLILPSATEAGLYSATDQIISLNA
ENVETVLVNSTAAIVAEFYASWCGHCVAFSPVYKSLARDIKEWKPAVDLAAVDCAATETR
QLCFDYGIKGYPTLKFFHAYSKEGSKGLSLKGFPRDVRGLRHRIIDQLEKHQEPWPPACP
PLELISQAEIDRFFETNSVQHIALIFEDDKSYIGREVTLDLLQFENIAVRRVLSTEEGLV
TKLGVTDFPSCYLYYPSGNFTRLQVNIQARTFYSYALQRLPGVVRSGKPPPPATVESLTN
RTDEPWRPFNRSRVYMADLESTLDYSLRVELAAHSVFSGHALVSLKKYISVLVKYFPGRP
MVMNLLKSLNSWLQDQPGDEISYEALEKIIDNRAQSPNTTLPQGARWVGCQGSQPHYRGY
PCGVWTLFHVLSVQAKKDEGTDAKEVLSTMRGYVHHFFGCRLCAKHFEEMAQKSLSEVNT
LSAAVLWLWKRHNQVNNRLAGALSEDPKFPKIQWPSPEMCPSCHSVMENREHRWNQDRVL
SFLLSYYSSQDILTGSLFSPPVRLSGREASDSLPLPSQPTVHSEEEEEEEEEEVQDEAAA
EEEAEGGEGATADEIARPSIVGMRMREQREDIVDLDSFVNQHYKAKAMQLAASSRVKQRT
LQKLDQDTQQQTKQRPKRELVGRYLTEEEWSHKRQWMSALSIGFSRVDISLCVILYFLSC
VCLLVMYLFFKSRLRLRKAKIA
Download sequence
Identical sequences H2TK27
ENSTRUP00000025031 31033.ENSTRUP00000025031 ENSTRUP00000025031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]