SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025032 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025032
Domain Number 1 Region: 402-504
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 7.06e-29
Family FAD-dependent thiol oxidase 0.0031
Further Details:      
 
Domain Number 2 Region: 39-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 4e-21
Family PDI-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025032   Gene: ENSTRUG00000009955   Transcript: ENSTRUT00000025135
Sequence length 735
Comment pep:known_by_projection scaffold:FUGU4:scaffold_122:270334:288023:1 gene:ENSTRUG00000009955 transcript:ENSTRUT00000025135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSRCAGGTQTHRRRTRATTAVWLLTYLILPSATEAGLYSATDQIISLNAENVETVLVNST
AAIVAEFYASWCGHCVAFSPVYKSLARDIKEWKPAVDLAAVDCAATETRQLCFDYGIKGY
PTLKFFHAYSKEGSKGLSLKGFPRDVRGLRHRIIDQLEKHQEPWPPACPPLELISQAEID
RFFETNSVQHIALIFEDDKSYIGREVTLDLLQFENIAVRRVLSTEEGLVTKLGVTDFPSC
YLYYPSGNFTRLQVNIQARTFYSYALQRLPGVVRSGKPPPPATVESLTNRTDEPWRPFNR
SRVYMADLESTLDYSLRVELAAHSVFSGHALVSLKKYISVLVKYFPGRPMVMNLLKSLNS
WLQDQPGDEISYEALEKIIDNRAQSPNTTLPQGARWVGCQGSQPHYRGYPCGVWTLFHVL
SVQAKKDEGTDAKEVLSTMRGYVHHFFGCRLCAKHFEEMAQKSLSEVNTLSAAVLWLWKR
HNQVNNRLAGALSEDPKFPKIQWPSPEMCPSCHSVMENREHRWNQDRVLSFLLSYYSSQD
ILTDYLEDENQILAKQREKHASQAVEARNRAERKAREASDSLPLPSQPTVHSEEEEEEEE
EEVQDEAAAEEDRVKQRTLQRKEEPEPGPVFGLGMELDAGFGMVGLQPLEAELDQDTQQQ
TKQRPKRELVGRYLTEEEWSHKRQWMSALSIGFSRVDISLCVILYFLSCVCLLVMYLFFK
SRLRLRKDHSAESAA
Download sequence
Identical sequences H2TK28
ENSTRUP00000025032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]