SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025112 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025112
Domain Number 1 Region: 126-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-69
Family Nuclear receptor ligand-binding domain 0.00000000578
Further Details:      
 
Domain Number 2 Region: 59-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025112   Gene: ENSTRUG00000009982   Transcript: ENSTRUT00000025215
Sequence length 474
Comment pep:known_by_projection scaffold:FUGU4:scaffold_304:251275:255603:1 gene:ENSTRUG00000009982 transcript:ENSTRUT00000025215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQSRCQADMDMADYSEALDPAYTTLEFENMQVLPLGTDSSPAETANMNASSHLGAGSLC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALIQADVLSRQITSPAPILNGDIRTKK
IAAITDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMLFK
DVLLLGNDYIIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIVFFDPDAKG
LSDPGKIKRMRYQVQVSLEDYINDRQYDCRGRFGELLLLLPTLQSITWQMIEQIQFVKLF
GMAKIDNLLQEMLLGGSANEAPHAPHSLHPHLVQEHLSSNVIVASSMPTPIHNGQIYSSP
APCAGQPATPETPIPSPPTASSSEHYKLPQGVIATVPKQPTSIPQPTITKQEAI
Download sequence
Identical sequences H2TKA8
ENSTRUP00000025112 31033.ENSTRUP00000025112 ENSTRUP00000025112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]