SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026286 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026286
Domain Number 1 Region: 183-463
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-76
Family Nuclear receptor ligand-binding domain 0.00000000309
Further Details:      
 
Domain Number 2 Region: 131-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.71e-26
Family Nuclear receptor 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026286   Gene: ENSTRUG00000010442   Transcript: ENSTRUT00000026393
Sequence length 504
Comment pep:known_by_projection scaffold:FUGU4:scaffold_431:13741:25028:-1 gene:ENSTRUG00000010442 transcript:ENSTRUT00000026393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYESLDVVGFSPSPSSPSAGSFLSMDYYHRPPGLGTEKGPLSTAAGFQRPFGGSLVNSRH
WSGSSHCELLHSSRSPFCWNSVKHLACLNNGVLLNVIMPPLSVAAIETESTSSGEDLLLP
SPPSPPPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKVCVIN
KVTRNRCQSCRLQKCLDVGMSRELVRNDRMKKKKDEKKPAEVETYVLSADTEQMIERVRR
AHQDTFPSLCQLGKYTTSNSSEHRVSLDVSLWDKFSELSTKCIIKTVEFAKQLPGFTTLT
IADQITLLKAACLDILILRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFSFA
SQLLPLEMDDAETGLLSAICLLCGDRQDLQESDKVDILQEPIVEALKMYVRRRRPEKPCM
FPKILMKITDLRSISVKGAERVITLKMEIPGSMPPLIQEMLENSDGVEGHGAGGGKESGR
PAAGCFQPKLKLRNSEQKPPPKQK
Download sequence
Identical sequences H2TNN0
31033.ENSTRUP00000026286 ENSTRUP00000026286 ENSTRUP00000026286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]