SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026288 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026288
Domain Number 1 Region: 153-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-76
Family Nuclear receptor ligand-binding domain 0.00000000309
Further Details:      
 
Domain Number 2 Region: 101-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.23e-26
Family Nuclear receptor 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026288   Gene: ENSTRUG00000010442   Transcript: ENSTRUT00000026395
Sequence length 479
Comment pep:known_by_projection scaffold:FUGU4:scaffold_431:14387:25052:-1 gene:ENSTRUG00000010442 transcript:ENSTRUT00000026395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPHPPSGMYESLDVVGFSPSPSSPSAGSFLSMDYYHRPPGLGTEKGPLSTAAGFQRPFG
GSLVNSRHWSGSSHSIETESTSSGEDLLLPSPPSPPPPPRVYKPCFVCQDKSSGYHYGVS
ACEGCKGFFRRSIQKNMVYTCHRDKVCVINKVTRNRCQSCRLQKCLDVGMSRELVRNDRM
KKKKDEKKPAEVETYVLSADTEQMIERVRRAHQDTFPSLCQLGKYTTSNSSEHRVSLDVS
LWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPDQDT
MTFSDGLTLNRTQMHNAGFGPLTDLVFSFASQLLPLEMDDAETGLLSAICLLCGDRQDLQ
ESDKVDILQEPIVEALKMYVRRRRPEKPCMFPKILMKITDLRSISVKGAERVITLKMEIP
GSMPPLIQEMLENSDGVEGHGAGGGKARKEEQMQQGSRRPSPSPKSIPSPSISPALGSP
Download sequence
Identical sequences H2TNN2
ENSTRUP00000026288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]