SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026513 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026513
Domain Number 1 Region: 476-649
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-49
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 152-217
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000336
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026513   Gene: ENSTRUG00000010509   Transcript: ENSTRUT00000026620
Sequence length 662
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:360768:365625:1 gene:ENSTRUG00000010509 transcript:ENSTRUT00000026620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIRMTSKLWTNEQFNCPVCLDLPNDPVTIPCGHSYCMACIKDFWSNDEPKGIYSCPQCRQ
VFCPMPPLSKNTMLADAVEQLRKGALKADVRDSIRSARGGTTSSSRPKAVACDMCKGEQR
EAVKSCLVCMSSYCEAHLKPHQTKKALKQHELVAPTSNLAEKICTQHKYLQEFFCRQCKT
FICWLCTSNQHKGHESVSTKVERLEKQKVLSDLQAETQQRLKEREQELKNLKKVMEVTKK
SQILTNPRTIIVSFPAQRSAIKVHSDTEQTLKELQRSVERLQELMEEVLDQANLEKMSQA
QEVADSLEAEIKVLKKRDSDMKDLAQSLFKPVTVTSEFFLSLSASRNAQKGGIFKHVKSS
GRIFIQLLVPFLVFSGLASRNTNTRSPGLRNQDVRSRDTPRVYQFTGPPSVSETTSIRNP
SPTPSRRETQSLWSRSINPSLFLDSPTPASMNHTPAFPALREINIDSLQAPEPRSREEFL
QYSVTLTLDPNTAHRRLGISEGNTKATLQGAAQPYPDTPERFDGWTQVMCQGPMYAQRCY
WEVEWRGRGSSIGVAYGAMSRKGSDAMSGLGYNARSWTLELSDTCCAALHDNQKRDIPVT
YSPRLGIYLDLSSGMLAFYSVADTMTHLHTFHANFTQPLYAVFGVGSGVGVGLDFALGKF
NS
Download sequence
Identical sequences H2TPA7
ENSTRUP00000026513 31033.ENSTRUP00000026513 ENSTRUP00000026513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]