SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026514 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026514
Domain Number 1 Region: 376-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-49
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 141-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000275
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000026514
Domain Number - Region: 262-339
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0288
Family EspA-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026514   Gene: ENSTRUG00000010509   Transcript: ENSTRUT00000026621
Sequence length 556
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:360771:365607:1 gene:ENSTRUG00000010509 transcript:ENSTRUT00000026621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRMTSKLWTNEQFNCPVCLDLPNDPVTIPCGHSYCMACIKDFWSNDEPKGIYSCPQCRQV
FCPMPPLSKNTMLADAVEQLRKGALKADVRDSIRSARAVACDMCKGEQREAVKSCLVCMS
SYCEAHLKPHQTKKALKQHELVAPTSNLAEKICTQHKYLQEFFCRQCKTFICWLCTSNQH
KGHESVSTKVERLEKQKVLSDLQAETQQRLKEREQELKNLKKVMEVTKRSAIKVHSDTEQ
TLKELQRSVERLQELMEEVLDQANLEKMSQAQEVADSLEAEIKVLKKRDSDMKDLAQCED
HIHYLQTCESMNSPLDTGDLPAVAVNLEASFEPVRDTVLDLREQVEDLCNQELGKFTKKM
REINIDSLQAPEPRSREEFLQYSVTLTLDPNTAHRRLGISEGNTKATLQGAAQPYPDTPE
RFDGWTQVMCQGPMYAQRCYWEVEWRGRGSSIGVAYGAMSRKGSDAMSGLGYNARSWTLE
LSDTCCAALHDNQKRDIPVTYSPRLGIYLDLSSGMLAFYSVADTMTHLHTFHANFTQPLY
AVFGVGSGVGVGLDFA
Download sequence
Identical sequences H2TPA8
ENSTRUP00000026514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]