SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026604 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026604
Domain Number 1 Region: 147-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-98
Family Protein kinases, catalytic subunit 0.0000000000432
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-24
Family Pleckstrin-homology domain (PH domain) 0.00000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026604   Gene: ENSTRUG00000010540   Transcript: ENSTRUT00000026711
Sequence length 481
Comment pep:known_by_projection scaffold:FUGU4:scaffold_188:557844:563371:1 gene:ENSTRUG00000010540 transcript:ENSTRUT00000026711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEVSVVREGWLFKRGEYIKTWRPRYFILKSDGSFIGYKEKPEVCDHSLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTSVIERTFHVDNHDDRKKWMQSIQAVANSLKSQQQDEERM
EIKFGSPCDNSGSENMEIAAFKSRTKVTMSDFDYLKLLGKGTFGKVILVKEKATGVYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFH
LSRDRVFTEDRARFYGAEIVSALEYLHSCNVVYRDLKLENLMLDKDGHIKITDFGLCKEG
ITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPKSLAPEGKELLNGLLRKDPKQRLGGGPDDAKDVMSHRFFTSINWQDVIEK
KLIPPFKPQVMSETDTRYFDEEFTAQTITITPPDRYGSLDAKESDHRTHFPQFSYSASIW
E
Download sequence
Identical sequences H2TPJ8
31033.ENSTRUP00000026604 XP_003968299.1.43653 ENSTRUP00000026604 ENSTRUP00000026604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]