SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026634 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026634
Domain Number 1 Region: 305-552
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-69
Family Nuclear receptor ligand-binding domain 0.00000000265
Further Details:      
 
Domain Number 2 Region: 66-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-31
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026634   Gene: ENSTRUG00000010553   Transcript: ENSTRUT00000026741
Sequence length 564
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:605657:746216:1 gene:ENSTRUG00000010553 transcript:ENSTRUT00000026741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPPDPASDPGNSASEPATPVRETPVNLETLRKADHPAPVRRQTCSSTNRGISVTKKTH
TSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQKNCLIDRTSRNR
CQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRLQQQQRDHQQQPGEAEPLTP
SYGLSANGLTELHDDLSGYMDGHTPDGSKPDSAPEPICDFAPGSGFFPYCSFTNGETSPT
VSMAELGTEQEGDKGRREERQEEGGQLNRGANDTKAVKGNVNKAFLGQKHSVSVWIPAIK
SAITVTPLIYIPSSKHLAQNISKSHMETCQYLREELQQMTWQAFLQEEVESYQSKPREVM
WQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFVRMCRAFDSQNNTV
YFDGKYAGPDVFKSLGCDDLISSVFEFGKNLCSMHLSEDEIALFSAFVLMSADRSWLQEK
VKVEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCSRHTEKLTAFKAIYPDIV
RAHFPPLYKELFGSDFEQSMPVDG
Download sequence
Identical sequences H2TPM8
ENSTRUP00000026634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]