SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027036 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027036
Domain Number 1 Region: 52-535
Classification Level Classification E-value
Superfamily Sema domain 3.53e-103
Family Sema domain 0.00072
Further Details:      
 
Domain Number 2 Region: 1414-1538,1704-1888
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.9e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 883-974
Classification Level Classification E-value
Superfamily E set domains 0.000000000000547
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 980-1054
Classification Level Classification E-value
Superfamily E set domains 0.0000000000058
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 1066-1145
Classification Level Classification E-value
Superfamily E set domains 0.0000000000196
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 6 Region: 537-590
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000192
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027036
Domain Number - Region: 840-878
Classification Level Classification E-value
Superfamily Plexin repeat 0.0314
Family Plexin repeat 0.0042
Further Details:      
 
Domain Number - Region: 1211-1259
Classification Level Classification E-value
Superfamily E set domains 0.098
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027036   Gene: ENSTRUG00000010718   Transcript: ENSTRUT00000027145
Sequence length 1928
Comment pep:known_by_projection scaffold:FUGU4:scaffold_180:453955:507422:-1 gene:ENSTRUG00000010718 transcript:ENSTRUT00000027145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THNFVIAQCTPRHRTRGSRPEGRMPPSIEIAVLILGVLVLEARRSASALHIQQAFPSPTQ
TNNFAVDPNSRKVYLATVNTIYQLNGTLSAEVEMRTGPVEDNLLCHAPQLPQAPCEHPKS
LTDNYNKLLELDREQGVVVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIA
ANHPNASTVGLIFKSGGNTRLLVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVK
DLPRLFTYDINPSEDNVFKIKQEVKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPN
SILARICLDTENPRKPSGPESRKLTESYIQMPLQCGFNGNIYNRLLSVYPADIPTEDGRE
PESHLFGVFSKGDRKSALCAFKFSDIEEEIRQGREKCSNSPSSDVQVLDSVIQGSGAACV
QKGKLTLQLEQLNCGAAHLQHPLALRRPLRALPLVEYPALTSVSVDCVHNHTVVFLGTSN
GRLRKLTFLANMTLANQWTLKLPASEAVHHLMTFDPSDSNYLYLMTSHHMLRVKVAQCDQ
WRSCGDCLGARDAHCGWCTLENRCSIQKECALGLLARSWISMGEGPQQCPSMTLTPPEIS
VSADIKDVGILINGSVPDLLGSRVECEYGPGVSTSATVHLDSGPAQIQTCPLLPRENYQS
ILPDTDHQAVSVAIKVNGTSVVSGSFIIYDCERTGAIHPKTSCVSCLSARWKCYWDQENH
LCVSNNCGCRNIPSPLSATSCPSLLASEVPPAPSGTAQDFTLSLSIIFAQQGEELECDFG
TEQRYEATWVNSSVVKCSGITLFTYHRSQIYHLNLRRKRFYSGRGEDVFVDSPQPVKVEV
YNCKVGSSDCSQCWGREDQGHLCGWCENSCKPRDDCQPIVEQCASPEIHKIFPLRGPVEG
GTLLTVQGRNLGRRAEAVKVSIGDVPCSLLPDRYTVSLELVCITGWSADEKTDIVQVDVE
QSGTGTSKESFSYLLPKLLYMEPNKGYHAGGTKVTITGEHLDIGSQVRVMVNSTHECVIT
EKTDNVIECTMPAVTQAHVSSVSVCVEFENLPCQRDDLSTTYTYKKNPTIFFIEPTKSYL
SGGRTITVTGQGFDLVQSAVMQVEGIGQTMCSVISNSTIHCPSHSSSESQQTSVRFFLNG
VLYTDESSSSSDSEEEEDEEGEDGDPNKDHFLLEYVEDPQFFTANKEKLIKHHPGEPLTL
IINKGPSDLDLVPEEYSVMIGSYPCNISFHNDQLFHCTINGLLGSSERELPVTVQVGNFR
HIIAKVQLGGSELAIVVSIVVCCVLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQ
IREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKQFVTRTFFPKMCSDYEKSLVLHAYE
NDGMGPRALPETHPLLQDWQATNTTKPNVEEGITLFSTLLNNKHFLVTFVHALEQQKDFA
VRDRCSLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNW
MSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENVEARPQN
INVSFQGCGMDSLSVRVMHTDTVCQVKEKTIEAFYKNLPFSQWPRAEDVDLEWLDSGANS
KLLQDLDNSSVMEDGRKKLNTVFHYQIPEGASLAMSLKDKKENTLGRVKDLDTEKYVHLV
LPHDELMETRKSHRHSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPPLAV
KYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHMDACLSV
IAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYKKRVQLYYQQIQEMSPLSEQEMNAHL
AEESRKYRNEFNTNLALTEIYKYAKRYRNQVVSALESNPTARRTQLHHKFEQVIALVEDN
IYECCSEA
Download sequence
Identical sequences H2TQS9
ENSTRUP00000027036 ENSTRUP00000027036 31033.ENSTRUP00000027036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]