SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027329 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027329
Domain Number 1 Region: 68-161
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 796-860
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000412
Family SAM (sterile alpha motif) domain 0.0084
Further Details:      
 
Domain Number 3 Region: 225-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000901
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027329   Gene: ENSTRUG00000010821   Transcript: ENSTRUT00000027438
Sequence length 898
Comment pep:known_by_projection scaffold:FUGU4:scaffold_203:437214:444361:1 gene:ENSTRUG00000010821 transcript:ENSTRUT00000027438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPEWVEERFRIDRKKLENMLYAPNLGNGETGEEFFERVMRETDTQVKWPSKLKIGAKSKK
DPHVKVEGKRDDVMEAKKRILKVLETKVNKVTLKMDVAYTEHSHVIGKGGGNIKKVMEVT
SCHIHFPDSNRHNGAGEKSNQVSIAGPVEGVEDARRRIRDLQPLSLTFDLPVSMVPQTLP
DAGSPLIQQVMQTLGVNVSFRAAPPHPQAQPAFYESCCTVWGLQGNATAVKKAACILMDL
LLGSEVTVSSQLDVTSQQHLFLLGQNGAPFLSVMHQTQTQIVLPDLSAPQSPPSLLIQGS
PDGVCLARQQLMDCLPVCLMFDMREDGDADPCKLAQMMQNLGVFISVKPKVKQTSKSVVV
KGLERNISCLYEARRQLLGLNSCVSAKVTQMTPDPAFASSGPANYWFNMLLQQLRLSEQD
LFGHNRATLIRQKNNLFRSLKSEEELSKVNVSSSPSPDVCDAGKSISRMGMMARRGSLQG
PEVPKPFLQGRRHSTGQALTYRNTFRPKVYSYSSNCSQLHPESDRLMNAQIEDRRNERRN
GLRRDALPGSDVLNSEVRAAQNQFTNCTSRHLFDLESHERPMKNVMSEKYYHQIVICSHG
SQKEEEESGKECGKTSEIATFHTAYFTSLPHAISTRSSRRLFLDTTTFLLPVQDYDYEKK
KLLATRAMQRKPVVTEVRTPTDTWSGLGFSKSMPAEAVKELRSISRRCYKPYLSTIGAQQ
NQSWAAQTAKVFNGSDSENWRDRRGSASSSVPVSSSSSSSSSSSSSPFEGFLSNSGGFEG
FCSSRRVSTCSQNSLSPQITDDLPELLSQLGLIKYIDIFEQQEIDYPTFLTLSDEDLKEV
GVFTFGARRKMLLAIADLSKSKRRLSDTLAVKPGYLEGGASGRLPRIMDVDAAQSNHW
Download sequence
Identical sequences H2TRM2
ENSTRUP00000027329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]