SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027695 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027695
Domain Number 1 Region: 31-143
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.74e-29
Family PDI-like 0.031
Further Details:      
 
Domain Number 2 Region: 244-372
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.62e-18
Family PDI-like 0.015
Further Details:      
 
Domain Number 3 Region: 146-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000537
Family Calsequestrin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027695   Gene: ENSTRUG00000010972   Transcript: ENSTRUT00000027804
Sequence length 411
Comment pep:known_by_projection scaffold:FUGU4:scaffold_48:309836:316232:1 gene:ENSTRUG00000010972 transcript:ENSTRUT00000027804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCAMKLLAISVFLDIRFISVLLLVMGLSSPGKAEIVHLDSGNIDEVLNNAGVALVNFYAD
WCRFSQMLHPIFEEASNIVREEFPSTHQVVFARVDCDQHSDIAQRYRINKYPTLKLFRNG
MMMKREYRGQRSVVAIADFIRQQQVDPVKELLTMEEANTVDRSKRNIIGYFETKDSDNYH
AYEKVANILRDDCTFSAAFGPASESERVGGDNMIYKPVGENVPDMVYLGSLASFDLAYAW
AQDKCVPLVREITFENGEELTEEGLPFLILFHINDDTESLEKFQQEVARQLISEKGTINF
LHADCEKFRHPLLHIQKSPTDCPVIAIDSFRHMYVFPDFKDLNIPGKLKQFVLDLHSGKL
HREFHHGPDPTNSTPGQEENEVASSPPKSSFQKLAPSETRYTILSRDRDEL
Download sequence
Identical sequences H2TSN7
ENSTRUP00000027695 ENSTRUP00000027695 31033.ENSTRUP00000027695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]