SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027703 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027703
Domain Number 1 Region: 2006-2305
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-126
Family BEACH domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 2425-2678
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.6e-32
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 1905-2004
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-27
Family PreBEACH PH-like domain 0.0028
Further Details:      
 
Domain Number 4 Region: 606-753
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000396
Family Laminin G-like module 0.053
Further Details:      
 
Domain Number 5 Region: 53-376,412-428,963-1286
Classification Level Classification E-value
Superfamily ARM repeat 0.00000094
Family PHAT domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027703   Gene: ENSTRUG00000010979   Transcript: ENSTRUT00000027813
Sequence length 2709
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:385266:413397:1 gene:ENSTRUG00000010979 transcript:ENSTRUT00000027813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMASKERLYEVWMLYCTKRDPDYLKLWLEIFLSSYERCLDVDFEKQPSRLEEIPPVLSLL
PDNILQVLRHQLLQCVQKASDGLEAEQQNLALLLLKFLIIICRNLSNVEEIGTCSYINHI
ITMTTLYIQQLKSKTKEKEMADQSQAEEFVRHALAFCESLYDPYRNWRHRTCSEQLGAVE
RSRQKYKAAPLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGDQKNALLAISPAT
MEVLMRVLADCTMGSCSSDEGEDWDSEAPDRKALLTLGCVREVVHRLLASSSDQRQVEIA
SVLENYFKLLNSDPAAVVAARQQQAVKAFFPSLSAHISDTIRDMFLCSDRPVLQAIFLNS
NCFEHLTRLLQNSKLVNARCTAADKDQKDITNNRLLTGERDTQVIQGRLDSLAVATIKTL
TTVMHKSPAAKEVFKERIGYNHLYEVLISLGQPSRHLLRELMNMAVEGDHSSVGLLGISN
VEPLLLLVQWLPDLDSSEQQIFMADWLRRISCLNRQTRATCVNAAMVMQALAVLERHQRL
HRACAESLFGLVGSLGSQSLSARELLGFLHLLRPPDSSKAHPYVGPALRSLLAMVRKQGL
ESAMQYFDLSPSMAGIVVPTVQRWPGSSISFFAWLSLDQDQLGPSSKDKRKQLYSFFTPG
GTGFEAFISSAGLLVVAVCTKKEYVTVLLPDYCFCDSLWHSIGVVHIPGKRPFGQSLVYI
YVDGQQKLSAPLKYPTMTEPFTSCCIGSAGHRTTTPPPSQIPDPPFSSSTTPTARSSLGG
ILSPQTWGGLLGTKSESMTKLISAGTQDSEWGSPTSLQGQLGTVMVFHEPLNCSHIKAIC
SAGPNCISPFKTQESELGDLSTKLLLHYSPKACKNPICLDLSPNMLHGRLTGNKVVNWDI
KDMINCVGGLSVLIPILEQLSLTTSEQQDPTAGSDFITPDVVTPADEDWVILPSNRASET
RLEKNLVAIFLLVLKHFLQRHPINQENLLHSHGVSTLGVLLQKLPAGHVDVSVLVAVQLL
IEQVTYEKNQTMLQQLHTHLLFNFNIWNKGDFPLRIGHIQYMSTVIKDNKKQFRKKCGVQ
FLLDTVRLYYGKNSNKESDLSEEDIRTVRASLYGLVKYYISKGMSQPEMLSILGYIAAIA
DEDQLCELLEVLVSLLQSCPVRDQLFLLLFEPAAADSCYALLLNNKHSDRLRELVFKLFE
RMLRFDRVHEKNKQRLRLRESGYSGLSLLFTDLHITPTLIRCLLNQILHTDNVVNYKDLM
SLVQLTHRAGPSVRLIVCKRLCQLLQSQQDAAVQISKQQCWQDTLMRLYLRGDGSLRGAD
TVSTCSLDLNRISGVHTNRLELPLEKISLVETPSSCASAEPPLHNRHCVVGISGGLTLDL
SHLLAYEGGESGNQTPGSMPSTPSPLETSKPFLGSTTDRDANSSMAEDSFLFSDNISLGE
SFNSGENGQQRAEEELCNLLLEIVLCVMWRGVEGSDDLAWLERGQVFSALTKLGTANELL
LPIDQIKLSLMERMLEWAVTDNREASAATLPQHTENAVRLLHIVQDFLQAEGLVNPALWT
DKVLEETVTLMDSLMVWYSAGTQWFQLCQVGLRLLLGFMAQEDPNVSAMATAKLNGILQT
KEVSSQDEACYLLGKVEGILRRSILEQTEEMYSFLVPLLRTLLSKVHRLLYMELHLPQLP
DTNGSPSFFEDFKMYCNSPEWRVYLDKYIIPYMKQYEIEIFSQGHETMALYWKECYEAFM
VSLHKRDRERGESKIRFQEQFVEPFSRRSRQENLRYNSMLKQQLSHNSAILRQWKAARRG
LVCERGPWADRQLSEMHWRVSTAENYSRMRLKLTRNYNFDPHREASALRDNLGVQHQRES
PESLLLEAVKQVKFSDLEDDILDLPEDDPAVANNQAEMEEASQKEKLILSEDCELVTIVD
VVPGRLELTTQHIYFYDSSQEKEEVSVGVGHDFKWPLSQIREVHLRRYNLRRSALEIFLI
DQTNYFLNFQKEVRNKVYSRMLQLRSLSFHGTRSPQELLKASGLTQKWVNREISNFDYLM
QLNTIAGRTYNNLAQYPVFPWILADYTSEELDLSDPRVFRDLSKPVAVLNERNAKVVREK
YENFEDPTGTIDRFHYGTHYSNAAGVIHYLIRVEPFTSLHIQLQSGRFDCADRQFHSIPA
TWQALMDNPNDVKELIPEFFYFPEFLENQNDFDLGRLQMSKERVNDVILPKWAKSPEDFI
YKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCTYEGAVDLDAITDEKER
KALECMISNFGQTPCQLLKEPHPVRLTLEEVVKRRAQLDSCALSMFEHLGELKSFFVEGI
CDRVPLVKVVVPKNQSHSFITQGSPDTMVTVSQNCLIGTHGWLPYNKNISNYFTFIKDPT
VSNTKTQKFLSKPFAPGVEVTAALFVVSHDSKLLFSGGHWDNSLRVTSLVKGKTVGQHIR
HMDIVTCLSTDHCGIHLISGSRDTTCMVWQIQQQGGTPVGLCPKPVQVLYGHMDEVVSVS
ISTELDMAVSGSRDGTVILHTVRRGQYMRCLRPPCDSSLPVSILHLAVSWEGHLLVHTCI
EGKATLKDKNILHLYSVNGKHLCSEPLEEQVTDMCVSGEYVVIGSKQGHLSIRNLYSLSL
CMEPMAMRVPIRCVSVTKEQSHILVGLEDGKLIIVGVGKPAEMHLGQIGRMLWGSSKTRT
QVSSGESAY
Download sequence
Identical sequences H2TSP5
ENSTRUP00000027703 ENSTRUP00000027703 31033.ENSTRUP00000027703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]