SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027706 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027706
Domain Number 1 Region: 1259-1558
Classification Level Classification E-value
Superfamily BEACH domain 1.03e-126
Family BEACH domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 1678-1931
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.95e-32
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 1158-1257
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-27
Family PreBEACH PH-like domain 0.0028
Further Details:      
 
Domain Number 4 Region: 41-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000246
Family Laminin G-like module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027706   Gene: ENSTRUG00000010979   Transcript: ENSTRUT00000027816
Sequence length 1962
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:398262:413397:1 gene:ENSTRUG00000010979 transcript:ENSTRUT00000027816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFLHLLRPPDSSKAHPYVGPALRSLLAMVRKQGLESAMQYFDLSPSMAGIVVPTVQRWP
GSSISFFAWLSLDQDQLGPSSKDKRKQLYSFFTPGGTGFEAFISSAGLLVVAVCTKKEYV
TVLLPDYCFCDSLWHSIGVVHIPGKRPFGQSLVYIYVDGQQKLSAPLKYPTMTEPFTSCC
IGSAGHRTTTPPPSQIPDPPFSSSTTPTARSSLGGILSPQTWGGLLGTKSESMTKLISAG
TQDSEWGSPTSLQGQLGTVMVFHEPLNCSHIKAICSAGPNCISPFKTQESELGDLSTKLL
LHYSPKACKNPICLDLSPNMLHGRLTGNKVVNWDIKDMINCVGGLSVLIPILEQLSLTTS
EQQDPTAGSDFITPDVVTPADEDWVILPSNRASETRLEKNLVAIFLLVLKHFLQRHPINQ
ENLLHSHGVSTLGVLLQKLPAGHVDVSVLVAVQLLIEQVTYEKNQTMLQQLHTHLLFNFN
IWNKGDFPLRIGHIQYMSTVIKDNKKQFRKKCGVQFLLDTVRLYYGKNSNKESDLSEEDI
RTVRASLYGLVKYYISKGMSQPEMLSILGYIAAIADEDQLFERMLRFDRVHEKNKQRLRL
RESGYSGLSLLFTDLHITPTLIRCLLNQILHTVSHLLAYEGGESGNQTPGSMPSTPSPLE
TSKPFLGSTTDRDANSSMAEDSFLFSDNISLGESFNSGENGQQRAEEELCNLLLEIVLCV
MWRGVEGSDDLAWLERGQVFSALTKLGTANELLLPIDQIKLSLMERMLEWAVTDNREASA
ATLPQHTENAVRLLHIVQDFLQAEGLVNPALWTDKVLEETVTLMDSLMVWYSAGTQWFQL
CQVGLRLLLGFMAQEDPNVSAMATAKLNGILQTKEVSSQDEACYLLGKVEGILRRSILEQ
TEEMYSFLVPLLRTLLSKVHRLLYMELHLPQLPDTNGSPSFFEDFKMYCNSPEWRVYLDK
YIIPYMKQYEIEIFSQGHETMALYWKECYEAFMVSLHKRDRERGESKIRFQEQFVEPFSR
RSRQENLRYNSMLKQQLSHNSAILRQWKAARRGLVCERGPWADRQLSEMHWRVSTAENYS
RMRLKLTRNYNFDPHREASALRDNLGVQHQRESPESLLLEAVKQVKFSDLEDDILDLPED
DPAVANNQAEMEEASQKEKLILSEDCELVTIVDVVPGRLELTTQHIYFYDSSQEKEEVSV
GVGHDFKWPLSQIREVHLRRYNLRRSALEIFLIDQTNYFLNFQKEVRNKVYSRMLQLRSL
SFHGTRSPQELLKASGLTQKWVNREISNFDYLMQLNTIAGRTYNNLAQYPVFPWILADYT
SEELDLSDPRVFRDLSKPVAVLNERNAKVVREKYENFEDPTGTIDRFHYGTHYSNAAGVI
HYLIRVEPFTSLHIQLQSGRFDCADRQFHSIPATWQALMDNPNDVKELIPEFFYFPEFLE
NQNDFDLGRLQMSKERVNDVILPKWAKSPEDFIYKHRKALESEYVSAHLHEWIDLIFGYK
QRGPAAVEALNVFYYCTYEGAVDLDAITDEKERKALECMISNFGQTPCQLLKEPHPVRLT
LEEVVKRRAQLDSCALSMFEHLGELKSFFVEGICDRVPLVKVVVPKNQSHSFITQGSPDT
MVTVSQNCLIGTHGWLPYNKNISNYFTFIKDPTVSNTKTQKFLSKPFAPGVEVTAALFVV
SHDSKLLFSGGHWDNSLRVTSLVKGKTVGQHIRHMDIVTCLSTDHCGIHLISGSRDTTCM
VWQIQQQGGTPVGLCPKPVQVLYGHMDEVVSVSISTELDMAVSGSRDGTVILHTVRRGQY
MRCLRPPCDSSLPVSILHLAVSWEGHLLVHTCIEGKATLKDKNILHLYSVNGKHLCSEPL
EEQVTDMCVSGEYVVIGSKQGHLSIRNLYSLSLCMEPMAMRVPIRCVSVTKEQSHILVGL
EDGKLIIVGVGKPAEMHLGQIGRMLWGSSKTRTQVSSGESAY
Download sequence
Identical sequences H2TSP8
ENSTRUP00000027706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]